


php-manual-en - The PHP Manual in the English language

Distribution: OpenMandriva Lx 3.0
Repository: OpenMandriva Contrib i586
Package name: php-manual-en
Package version: 5.5.7
Package release: 2-omv2015.0
Package architecture: noarch
Package type: rpm
Installed size: 72.61 MB
Download size: 7.21 MB
Official Mirror:
The PHP Manual in the English (en) language.




  • config(php-manual-en) == 0:5.5.7-2:2015.0
  • php-manual-en == 5.5.7-2:2015.0

    Install Howto

    1. Enable OpenMandriva Contrib repository on Install and Remove Software"
    2. Update packages list:
      # urpmi.update -a
    3. Install php-manual-en rpm package:
      # urpmi php-manual-en


    • /etc/httpd/conf/webapps.d/php-manual-en.conf
    • /etc/php.d/php-manual-en.ini
    • /usr/share/applications/php-manual-en.desktop
    • /usr/share/doc/php-manual-en/about.formats.html
    • /usr/share/doc/php-manual-en/about.generate.html
    • /usr/share/doc/php-manual-en/about.howtohelp.html
    • /usr/share/doc/php-manual-en/about.html
    • /usr/share/doc/php-manual-en/about.more.html
    • /usr/share/doc/php-manual-en/about.notes.html
    • /usr/share/doc/php-manual-en/about.phpversions.html
    • /usr/share/doc/php-manual-en/about.prototypes.html
    • /usr/share/doc/php-manual-en/about.translations.html
    • /usr/share/doc/php-manual-en/aliases.html
    • /usr/share/doc/php-manual-en/amqp.configuration.html
    • /usr/share/doc/php-manual-en/amqp.constants.html
    • /usr/share/doc/php-manual-en/amqp.examples.html
    • /usr/share/doc/php-manual-en/amqp.installation.html
    • /usr/share/doc/php-manual-en/amqp.requirements.html
    • /usr/share/doc/php-manual-en/amqp.resources.html
    • /usr/share/doc/php-manual-en/amqp.setup.html
    • /usr/share/doc/php-manual-en/amqpchannel.committransaction.html
    • /usr/share/doc/php-manual-en/amqpchannel.construct.html
    • /usr/share/doc/php-manual-en/amqpchannel.isconnected.html
    • /usr/share/doc/php-manual-en/amqpchannel.qos.html
    • /usr/share/doc/php-manual-en/amqpchannel.rollbacktransaction.html
    • /usr/share/doc/php-manual-en/amqpchannel.setprefetchcount.html
    • /usr/share/doc/php-manual-en/amqpchannel.setprefetchsize.html
    • /usr/share/doc/php-manual-en/amqpchannel.starttransaction.html
    • /usr/share/doc/php-manual-en/amqpconnection.connect.html
    • /usr/share/doc/php-manual-en/amqpconnection.construct.html
    • /usr/share/doc/php-manual-en/amqpconnection.disconnect.html
    • /usr/share/doc/php-manual-en/amqpconnection.gethost.html
    • /usr/share/doc/php-manual-en/amqpconnection.getlogin.html
    • /usr/share/doc/php-manual-en/amqpconnection.getpassword.html
    • /usr/share/doc/php-manual-en/amqpconnection.getport.html
    • /usr/share/doc/php-manual-en/amqpconnection.gettimeout.html
    • /usr/share/doc/php-manual-en/amqpconnection.getvhost.html
    • /usr/share/doc/php-manual-en/amqpconnection.isconnected.html
    • /usr/share/doc/php-manual-en/amqpconnection.reconnect.html
    • /usr/share/doc/php-manual-en/amqpconnection.sethost.html
    • /usr/share/doc/php-manual-en/amqpconnection.setlogin.html
    • /usr/share/doc/php-manual-en/amqpconnection.setpassword.html
    • /usr/share/doc/php-manual-en/amqpconnection.setport.html
    • /usr/share/doc/php-manual-en/amqpconnection.settimeout.html
    • /usr/share/doc/php-manual-en/amqpconnection.setvhost.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getappid.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getbody.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getcontentencoding.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getcontenttype.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getcorrelationid.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getdeliverytag.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getexchange.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getexpiration.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getheader.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getheaders.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getmessageid.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getpriority.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getreplyto.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getroutingkey.html
    • /usr/share/doc/php-manual-en/amqpenvelope.gettimestamp.html
    • /usr/share/doc/php-manual-en/amqpenvelope.gettype.html
    • /usr/share/doc/php-manual-en/amqpenvelope.getuserid.html
    • /usr/share/doc/php-manual-en/amqpenvelope.isredelivery.html
    • /usr/share/doc/php-manual-en/amqpexchange.bind.html
    • /usr/share/doc/php-manual-en/amqpexchange.construct.html
    • /usr/share/doc/php-manual-en/amqpexchange.declare.html
    • /usr/share/doc/php-manual-en/amqpexchange.delete.html
    • /usr/share/doc/php-manual-en/amqpexchange.getargument.html
    • /usr/share/doc/php-manual-en/amqpexchange.getarguments.html
    • /usr/share/doc/php-manual-en/amqpexchange.getflags.html
    • /usr/share/doc/php-manual-en/amqpexchange.getname.html
    • /usr/share/doc/php-manual-en/amqpexchange.gettype.html
    • /usr/share/doc/php-manual-en/amqpexchange.publish.html
    • /usr/share/doc/php-manual-en/amqpexchange.setargument.html
    • /usr/share/doc/php-manual-en/amqpexchange.setarguments.html
    • /usr/share/doc/php-manual-en/amqpexchange.setflags.html
    • /usr/share/doc/php-manual-en/amqpexchange.setname.html
    • /usr/share/doc/php-manual-en/amqpexchange.settype.html
    • /usr/share/doc/php-manual-en/amqpqueue.ack.html
    • /usr/share/doc/php-manual-en/amqpqueue.bind.html
    • /usr/share/doc/php-manual-en/amqpqueue.cancel.html
    • /usr/share/doc/php-manual-en/amqpqueue.construct.html
    • /usr/share/doc/php-manual-en/amqpqueue.consume.html
    • /usr/share/doc/php-manual-en/amqpqueue.declare.html
    • /usr/share/doc/php-manual-en/amqpqueue.delete.html
    • /usr/share/doc/php-manual-en/amqpqueue.get.html
    • /usr/share/doc/php-manual-en/amqpqueue.getargument.html
    • /usr/share/doc/php-manual-en/amqpqueue.getarguments.html
    • /usr/share/doc/php-manual-en/amqpqueue.getflags.html
    • /usr/share/doc/php-manual-en/amqpqueue.getname.html
    • /usr/share/doc/php-manual-en/amqpqueue.nack.html
    • /usr/share/doc/php-manual-en/amqpqueue.purge.html
    • /usr/share/doc/php-manual-en/amqpqueue.setargument.html
    • /usr/share/doc/php-manual-en/amqpqueue.setarguments.html
    • /usr/share/doc/php-manual-en/amqpqueue.setflags.html
    • /usr/share/doc/php-manual-en/amqpqueue.setname.html
    • /usr/share/doc/php-manual-en/amqpqueue.unbind.html
    • /usr/share/doc/php-manual-en/apache.configuration.html
    • /usr/share/doc/php-manual-en/apache.constants.html
    • /usr/share/doc/php-manual-en/apache.installation.html
    • /usr/share/doc/php-manual-en/apache.requirements.html
    • /usr/share/doc/php-manual-en/apache.resources.html
    • /usr/share/doc/php-manual-en/apache.setup.html
    • /usr/share/doc/php-manual-en/apc.configuration.html
    • /usr/share/doc/php-manual-en/apc.constants.html
    • /usr/share/doc/php-manual-en/apc.installation.html
    • /usr/share/doc/php-manual-en/apc.requirements.html
    • /usr/share/doc/php-manual-en/apc.resources.html
    • /usr/share/doc/php-manual-en/apc.setup.html
    • /usr/share/doc/php-manual-en/apciterator.construct.html
    • /usr/share/doc/php-manual-en/apciterator.current.html
    • /usr/share/doc/php-manual-en/apciterator.gettotalcount.html
    • /usr/share/doc/php-manual-en/apciterator.gettotalhits.html
    • /usr/share/doc/php-manual-en/apciterator.gettotalsize.html
    • /usr/share/doc/php-manual-en/apciterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/apciterator.rewind.html
    • /usr/share/doc/php-manual-en/apciterator.valid.html
    • /usr/share/doc/php-manual-en/apd.configuration.html
    • /usr/share/doc/php-manual-en/apd.constants.html
    • /usr/share/doc/php-manual-en/apd.examples.html
    • /usr/share/doc/php-manual-en/apd.examples.usage.html
    • /usr/share/doc/php-manual-en/apd.installation.html
    • /usr/share/doc/php-manual-en/apd.installwin32.html
    • /usr/share/doc/php-manual-en/apd.requirements.html
    • /usr/share/doc/php-manual-en/apd.resources.html
    • /usr/share/doc/php-manual-en/apd.setup.html
    • /usr/share/doc/php-manual-en/appendices.html
    • /usr/share/doc/php-manual-en/appenditerator.append.html
    • /usr/share/doc/php-manual-en/appenditerator.construct.html
    • /usr/share/doc/php-manual-en/appenditerator.current.html
    • /usr/share/doc/php-manual-en/appenditerator.getarrayiterator.html
    • /usr/share/doc/php-manual-en/appenditerator.getinneriterator.html
    • /usr/share/doc/php-manual-en/appenditerator.getiteratorindex.html
    • /usr/share/doc/php-manual-en/appenditerator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/appenditerator.rewind.html
    • /usr/share/doc/php-manual-en/appenditerator.valid.html
    • /usr/share/doc/php-manual-en/array.configuration.html
    • /usr/share/doc/php-manual-en/array.constants.html
    • /usr/share/doc/php-manual-en/array.installation.html
    • /usr/share/doc/php-manual-en/array.requirements.html
    • /usr/share/doc/php-manual-en/array.resources.html
    • /usr/share/doc/php-manual-en/array.setup.html
    • /usr/share/doc/php-manual-en/array.sorting.html
    • /usr/share/doc/php-manual-en/arrayaccess.offsetexists.html
    • /usr/share/doc/php-manual-en/arrayaccess.offsetget.html
    • /usr/share/doc/php-manual-en/arrayaccess.offsetset.html
    • /usr/share/doc/php-manual-en/arrayaccess.offsetunset.html
    • /usr/share/doc/php-manual-en/arrayiterator.append.html
    • /usr/share/doc/php-manual-en/arrayiterator.asort.html
    • /usr/share/doc/php-manual-en/arrayiterator.construct.html
    • /usr/share/doc/php-manual-en/arrayiterator.count.html
    • /usr/share/doc/php-manual-en/arrayiterator.current.html
    • /usr/share/doc/php-manual-en/arrayiterator.getarraycopy.html
    • /usr/share/doc/php-manual-en/arrayiterator.getflags.html
    • /usr/share/doc/php-manual-en/arrayiterator.key.html
    • /usr/share/doc/php-manual-en/arrayiterator.ksort.html
    • /usr/share/doc/php-manual-en/arrayiterator.natcasesort.html
    • /usr/share/doc/php-manual-en/arrayiterator.natsort.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/arrayiterator.offsetexists.html
    • /usr/share/doc/php-manual-en/arrayiterator.offsetget.html
    • /usr/share/doc/php-manual-en/arrayiterator.offsetset.html
    • /usr/share/doc/php-manual-en/arrayiterator.offsetunset.html
    • /usr/share/doc/php-manual-en/arrayiterator.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/arrayiterator.serialize.html
    • /usr/share/doc/php-manual-en/arrayiterator.setflags.html
    • /usr/share/doc/php-manual-en/arrayiterator.uasort.html
    • /usr/share/doc/php-manual-en/arrayiterator.uksort.html
    • /usr/share/doc/php-manual-en/arrayiterator.unserialize.html
    • /usr/share/doc/php-manual-en/arrayiterator.valid.html
    • /usr/share/doc/php-manual-en/arrayobject.append.html
    • /usr/share/doc/php-manual-en/arrayobject.asort.html
    • /usr/share/doc/php-manual-en/arrayobject.construct.html
    • /usr/share/doc/php-manual-en/arrayobject.count.html
    • /usr/share/doc/php-manual-en/arrayobject.exchangearray.html
    • /usr/share/doc/php-manual-en/arrayobject.getarraycopy.html
    • /usr/share/doc/php-manual-en/arrayobject.getflags.html
    • /usr/share/doc/php-manual-en/arrayobject.getiterator.html
    • /usr/share/doc/php-manual-en/arrayobject.getiteratorclass.html
    • /usr/share/doc/php-manual-en/arrayobject.ksort.html
    • /usr/share/doc/php-manual-en/arrayobject.natcasesort.html
    • /usr/share/doc/php-manual-en/arrayobject.natsort.html
    • /usr/share/doc/php-manual-en/arrayobject.offsetexists.html
    • /usr/share/doc/php-manual-en/arrayobject.offsetget.html
    • /usr/share/doc/php-manual-en/arrayobject.offsetset.html
    • /usr/share/doc/php-manual-en/arrayobject.offsetunset.html
    • /usr/share/doc/php-manual-en/arrayobject.serialize.html
    • /usr/share/doc/php-manual-en/arrayobject.setflags.html
    • /usr/share/doc/php-manual-en/arrayobject.setiteratorclass.html
    • /usr/share/doc/php-manual-en/arrayobject.uasort.html
    • /usr/share/doc/php-manual-en/arrayobject.uksort.html
    • /usr/share/doc/php-manual-en/arrayobject.unserialize.html
    • /usr/share/doc/php-manual-en/audioproperties.getbitrate.html
    • /usr/share/doc/php-manual-en/audioproperties.getchannels.html
    • /usr/share/doc/php-manual-en/audioproperties.getlayer.html
    • /usr/share/doc/php-manual-en/audioproperties.getlength.html
    • /usr/share/doc/php-manual-en/audioproperties.getsamplebitrate.html
    • /usr/share/doc/php-manual-en/audioproperties.getversion.html
    • /usr/share/doc/php-manual-en/audioproperties.iscopyrighted.html
    • /usr/share/doc/php-manual-en/audioproperties.isoriginal.html
    • /usr/share/doc/php-manual-en/audioproperties.isprotectionenabled.html
    • /usr/share/doc/php-manual-en/bbcode.configuration.html
    • /usr/share/doc/php-manual-en/bbcode.constants.html
    • /usr/share/doc/php-manual-en/bbcode.installation.html
    • /usr/share/doc/php-manual-en/bbcode.requirements.html
    • /usr/share/doc/php-manual-en/bbcode.resources.html
    • /usr/share/doc/php-manual-en/bbcode.setup.html
    • /usr/share/doc/php-manual-en/bc.configuration.html
    • /usr/share/doc/php-manual-en/bc.constants.html
    • /usr/share/doc/php-manual-en/bc.installation.html
    • /usr/share/doc/php-manual-en/bc.requirements.html
    • /usr/share/doc/php-manual-en/bc.resources.html
    • /usr/share/doc/php-manual-en/bc.setup.html
    • /usr/share/doc/php-manual-en/bcompiler.configuration.html
    • /usr/share/doc/php-manual-en/bcompiler.constants.html
    • /usr/share/doc/php-manual-en/bcompiler.installation.html
    • /usr/share/doc/php-manual-en/bcompiler.requirements.html
    • /usr/share/doc/php-manual-en/bcompiler.resources.html
    • /usr/share/doc/php-manual-en/bcompiler.setup.html
    • /usr/share/doc/php-manual-en/blenc.configuration.html
    • /usr/share/doc/php-manual-en/blenc.constants.html
    • /usr/share/doc/php-manual-en/blenc.installation.html
    • /usr/share/doc/php-manual-en/blenc.requirements.html
    • /usr/share/doc/php-manual-en/blenc.resources.html
    • /usr/share/doc/php-manual-en/blenc.setup.html
    • /usr/share/doc/php-manual-en/book.amqp.html
    • /usr/share/doc/php-manual-en/book.apache.html
    • /usr/share/doc/php-manual-en/book.apc.html
    • /usr/share/doc/php-manual-en/book.apd.html
    • /usr/share/doc/php-manual-en/book.array.html
    • /usr/share/doc/php-manual-en/book.bbcode.html
    • /usr/share/doc/php-manual-en/book.bc.html
    • /usr/share/doc/php-manual-en/book.bcompiler.html
    • /usr/share/doc/php-manual-en/book.blenc.html
    • /usr/share/doc/php-manual-en/book.bzip2.html
    • /usr/share/doc/php-manual-en/book.cairo.html
    • /usr/share/doc/php-manual-en/book.calendar.html
    • /usr/share/doc/php-manual-en/book.chdb.html
    • /usr/share/doc/php-manual-en/book.classkit.html
    • /usr/share/doc/php-manual-en/book.classobj.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.crack.html
    • /usr/share/doc/php-manual-en/book.ctype.html
    • /usr/share/doc/php-manual-en/book.cubrid.html
    • /usr/share/doc/php-manual-en/book.curl.html
    • /usr/share/doc/php-manual-en/book.cyrus.html
    • /usr/share/doc/php-manual-en/book.datetime.html
    • /usr/share/doc/php-manual-en/book.dba.html
    • /usr/share/doc/php-manual-en/book.dbase.html
    • /usr/share/doc/php-manual-en/book.dbplus.html
    • /usr/share/doc/php-manual-en/book.dbx.html
    • /usr/share/doc/php-manual-en/book.dio.html
    • /usr/share/doc/php-manual-en/book.dir.html
    • /usr/share/doc/php-manual-en/book.dom.html
    • /usr/share/doc/php-manual-en/book.dotnet.html
    • /usr/share/doc/php-manual-en/book.eio.html
    • /usr/share/doc/php-manual-en/book.enchant.html
    • /usr/share/doc/php-manual-en/book.errorfunc.html
    • /usr/share/doc/php-manual-en/book.ev.html
    • /usr/share/doc/php-manual-en/book.event.html
    • /usr/share/doc/php-manual-en/book.exec.html
    • /usr/share/doc/php-manual-en/book.exif.html
    • /usr/share/doc/php-manual-en/book.expect.html
    • /usr/share/doc/php-manual-en/book.fam.html
    • /usr/share/doc/php-manual-en/book.fann.html
    • /usr/share/doc/php-manual-en/book.fbsql.html
    • /usr/share/doc/php-manual-en/book.fdf.html
    • /usr/share/doc/php-manual-en/book.fileinfo.html
    • /usr/share/doc/php-manual-en/book.filepro.html
    • /usr/share/doc/php-manual-en/book.filesystem.html
    • /usr/share/doc/php-manual-en/book.filter.html
    • /usr/share/doc/php-manual-en/book.fpm.html
    • /usr/share/doc/php-manual-en/book.fribidi.html
    • /usr/share/doc/php-manual-en/book.ftp.html
    • /usr/share/doc/php-manual-en/book.funchand.html
    • /usr/share/doc/php-manual-en/book.gearman.html
    • /usr/share/doc/php-manual-en/book.gender.html
    • /usr/share/doc/php-manual-en/book.geoip.html
    • /usr/share/doc/php-manual-en/book.gettext.html
    • /usr/share/doc/php-manual-en/book.gmagick.html
    • /usr/share/doc/php-manual-en/book.gmp.html
    • /usr/share/doc/php-manual-en/book.gnupg.html
    • /usr/share/doc/php-manual-en/book.gupnp.html
    • /usr/share/doc/php-manual-en/book.haru.html
    • /usr/share/doc/php-manual-en/book.hash.html
    • /usr/share/doc/php-manual-en/book.htscanner.html
    • /usr/share/doc/php-manual-en/book.http.html
    • /usr/share/doc/php-manual-en/book.hw.html
    • /usr/share/doc/php-manual-en/book.hwapi.html
    • /usr/share/doc/php-manual-en/book.ibase.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.iconv.html
    • /usr/share/doc/php-manual-en/book.id3.html
    • /usr/share/doc/php-manual-en/book.ifx.html
    • /usr/share/doc/php-manual-en/book.iisfunc.html
    • /usr/share/doc/php-manual-en/book.image.html
    • /usr/share/doc/php-manual-en/book.imagick.html
    • /usr/share/doc/php-manual-en/book.imap.html
    • /usr/share/doc/php-manual-en/book.inclued.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.ingres.html
    • /usr/share/doc/php-manual-en/book.inotify.html
    • /usr/share/doc/php-manual-en/book.intl.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.json.html
    • /usr/share/doc/php-manual-en/book.judy.html
    • /usr/share/doc/php-manual-en/book.kadm5.html
    • /usr/share/doc/php-manual-en/book.ktaglib.html
    • /usr/share/doc/php-manual-en/book.lapack.html
    • /usr/share/doc/php-manual-en/book.ldap.html
    • /usr/share/doc/php-manual-en/book.libevent.html
    • /usr/share/doc/php-manual-en/book.libxml.html
    • /usr/share/doc/php-manual-en/book.lua.html
    • /usr/share/doc/php-manual-en/book.lzf.html
    • /usr/share/doc/php-manual-en/book.mail.html
    • /usr/share/doc/php-manual-en/book.mailparse.html
    • /usr/share/doc/php-manual-en/book.math.html
    • /usr/share/doc/php-manual-en/book.maxdb.html
    • /usr/share/doc/php-manual-en/book.mbstring.html
    • /usr/share/doc/php-manual-en/book.mcrypt.html
    • /usr/share/doc/php-manual-en/book.mcve.html
    • /usr/share/doc/php-manual-en/book.memcache.html
    • /usr/share/doc/php-manual-en/book.memcached.html
    • /usr/share/doc/php-manual-en/book.memtrack.html
    • /usr/share/doc/php-manual-en/book.mhash.html
    • /usr/share/doc/php-manual-en/book.mime-magic.html
    • /usr/share/doc/php-manual-en/book.ming.html
    • /usr/share/doc/php-manual-en/book.misc.html
    • /usr/share/doc/php-manual-en/book.mnogosearch.html
    • /usr/share/doc/php-manual-en/book.mongo.html
    • /usr/share/doc/php-manual-en/book.mqseries.html
    • /usr/share/doc/php-manual-en/book.msession.html
    • /usr/share/doc/php-manual-en/book.msql.html
    • /usr/share/doc/php-manual-en/book.mssql.html
    • /usr/share/doc/php-manual-en/book.mysql.html
    • /usr/share/doc/php-manual-en/book.mysqli.html
    • /usr/share/doc/php-manual-en/book.mysqlnd-memcache.html
    • /usr/share/doc/php-manual-en/book.mysqlnd-ms.html
    • /usr/share/doc/php-manual-en/book.mysqlnd-mux.html
    • /usr/share/doc/php-manual-en/book.mysqlnd-qc.html
    • /usr/share/doc/php-manual-en/book.mysqlnd-uh.html
    • /usr/share/doc/php-manual-en/book.mysqlnd.html
    • /usr/share/doc/php-manual-en/book.ncurses.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.newt.html
    • /usr/share/doc/php-manual-en/book.nis.html
    • /usr/share/doc/php-manual-en/book.notes.html
    • /usr/share/doc/php-manual-en/book.nsapi.html
    • /usr/share/doc/php-manual-en/book.oauth.html
    • /usr/share/doc/php-manual-en/book.objaggregation.html
    • /usr/share/doc/php-manual-en/book.oci8.html
    • /usr/share/doc/php-manual-en/book.oggvorbis.html
    • /usr/share/doc/php-manual-en/book.opcache.html
    • /usr/share/doc/php-manual-en/book.openal.html
    • /usr/share/doc/php-manual-en/book.openssl.html
    • /usr/share/doc/php-manual-en/book.outcontrol.html
    • /usr/share/doc/php-manual-en/book.ovrimos.html
    • /usr/share/doc/php-manual-en/book.paradox.html
    • /usr/share/doc/php-manual-en/book.parsekit.html
    • /usr/share/doc/php-manual-en/book.password.html
    • /usr/share/doc/php-manual-en/book.pcntl.html
    • /usr/share/doc/php-manual-en/book.pcre.html
    • /usr/share/doc/php-manual-en/book.pdf.html
    • /usr/share/doc/php-manual-en/book.pdo.html
    • /usr/share/doc/php-manual-en/book.pgsql.html
    • /usr/share/doc/php-manual-en/book.phar.html
    • /usr/share/doc/php-manual-en/book.posix.html
    • /usr/share/doc/php-manual-en/book.printer.html
    • /usr/share/doc/php-manual-en/book.proctitle.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.pspell.html
    • /usr/share/doc/php-manual-en/book.pthreads.html
    • /usr/share/doc/php-manual-en/book.qtdom.html
    • /usr/share/doc/php-manual-en/book.quickhash.html
    • /usr/share/doc/php-manual-en/book.radius.html
    • /usr/share/doc/php-manual-en/book.rar.html
    • /usr/share/doc/php-manual-en/book.readline.html
    • /usr/share/doc/php-manual-en/book.recode.html
    • /usr/share/doc/php-manual-en/book.reflection.html
    • /usr/share/doc/php-manual-en/book.regex.html
    • /usr/share/doc/php-manual-en/book.rpmreader.html
    • /usr/share/doc/php-manual-en/book.rrd.html
    • /usr/share/doc/php-manual-en/book.runkit.html
    • /usr/share/doc/php-manual-en/book.sam.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.scream.html
    • /usr/share/doc/php-manual-en/book.sdo-das-xml.html
    • /usr/share/doc/php-manual-en/book.sdo.html
    • /usr/share/doc/php-manual-en/book.sdodasrel.html
    • /usr/share/doc/php-manual-en/book.sem.html
    • /usr/share/doc/php-manual-en/book.session-pgsql.html
    • /usr/share/doc/php-manual-en/book.session.html
    • /usr/share/doc/php-manual-en/book.shmop.html
    • /usr/share/doc/php-manual-en/book.simplexml.html
    • /usr/share/doc/php-manual-en/book.snmp.html
    • /usr/share/doc/php-manual-en/book.soap.html
    • /usr/share/doc/php-manual-en/book.sockets.html
    • /usr/share/doc/php-manual-en/book.solr.html
    • /usr/share/doc/php-manual-en/book.sphinx.html
    • /usr/share/doc/php-manual-en/book.spl-types.html
    • /usr/share/doc/php-manual-en/book.spl.html
    • /usr/share/doc/php-manual-en/book.spplus.html
    • /usr/share/doc/php-manual-en/book.sqlite.html
    • /usr/share/doc/php-manual-en/book.sqlite3.html
    • /usr/share/doc/php-manual-en/book.sqlsrv.html
    • /usr/share/doc/php-manual-en/book.ssdeep.html
    • /usr/share/doc/php-manual-en/book.ssh2.html
    • /usr/share/doc/php-manual-en/book.stats.html
    • /usr/share/doc/php-manual-en/book.stomp.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.strings.html
    • /usr/share/doc/php-manual-en/book.svm.html
    • /usr/share/doc/php-manual-en/book.svn.html
    • /usr/share/doc/php-manual-en/book.swf.html
    • /usr/share/doc/php-manual-en/book.swish.html
    • /usr/share/doc/php-manual-en/book.sybase.html
    • /usr/share/doc/php-manual-en/book.taint.html
    • /usr/share/doc/php-manual-en/book.tcpwrap.html
    • /usr/share/doc/php-manual-en/book.tidy.html
    • /usr/share/doc/php-manual-en/book.tokenizer.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.trader.html
    • /usr/share/doc/php-manual-en/book.uodbc.html
    • /usr/share/doc/php-manual-en/book.url.html
    • /usr/share/doc/php-manual-en/book.v8js.html
    • /usr/share/doc/php-manual-en/book.var.html
    • /usr/share/doc/php-manual-en/book.varnish.html
    • /usr/share/doc/php-manual-en/book.vpopmail.html
    • /usr/share/doc/php-manual-en/book.w32api.html
    • /usr/share/doc/php-manual-en/book.wddx.html
    • /usr/share/doc/php-manual-en/book.weakref.html
    • /usr/share/doc/php-manual-en/book.win32ps.html
    • /usr/share/doc/php-manual-en/book.win32service.html
    • /usr/share/doc/php-manual-en/book.wincache.html
    • /usr/share/doc/php-manual-en/book.xattr.html
    • /usr/share/doc/php-manual-en/book.xdiff.html
    • /usr/share/doc/php-manual-en/book.xhprof.html
    • /usr/share/doc/php-manual-en/book.xml.html
    • /usr/share/doc/php-manual-en/book.xmldiff.html
    • /usr/share/doc/php-manual-en/book.xmlreader.html
    • /usr/share/doc/php-manual-en/book.xmlrpc.html
    • /usr/share/doc/php-manual-en/book.xmlwriter.html
    • /usr/share/doc/php-manual-en/book.xsl.html
    • /usr/share/doc/php-manual-en/book.xslt.html
    • /usr/share/doc/php-manual-en/book.yaf.html
    • /usr/share/doc/php-manual-en/book.yaml.html
    • /usr/share/doc/php-manual-en/book.yar.html
    • /usr/share/doc/php-manual-en/book.yaz.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/book.zlib.html
    • /usr/share/doc/php-manual-en/book.zmq.html
    • /usr/share/doc/php-manual-en/bzip2.configuration.html
    • /usr/share/doc/php-manual-en/bzip2.constants.html
    • /usr/share/doc/php-manual-en/bzip2.examples.html
    • /usr/share/doc/php-manual-en/bzip2.installation.html
    • /usr/share/doc/php-manual-en/bzip2.requirements.html
    • /usr/share/doc/php-manual-en/bzip2.resources.html
    • /usr/share/doc/php-manual-en/bzip2.setup.html
    • /usr/share/doc/php-manual-en/cachingiterator.construct.html
    • /usr/share/doc/php-manual-en/cachingiterator.count.html
    • /usr/share/doc/php-manual-en/cachingiterator.current.html
    • /usr/share/doc/php-manual-en/cachingiterator.getcache.html
    • /usr/share/doc/php-manual-en/cachingiterator.getflags.html
    • /usr/share/doc/php-manual-en/cachingiterator.getinneriterator.html
    • /usr/share/doc/php-manual-en/cachingiterator.hasnext.html
    • /usr/share/doc/php-manual-en/cachingiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/cachingiterator.offsetexists.html
    • /usr/share/doc/php-manual-en/cachingiterator.offsetget.html
    • /usr/share/doc/php-manual-en/cachingiterator.offsetset.html
    • /usr/share/doc/php-manual-en/cachingiterator.offsetunset.html
    • /usr/share/doc/php-manual-en/cachingiterator.rewind.html
    • /usr/share/doc/php-manual-en/cachingiterator.setflags.html
    • /usr/share/doc/php-manual-en/cachingiterator.tostring.html
    • /usr/share/doc/php-manual-en/cachingiterator.valid.html
    • /usr/share/doc/php-manual-en/cairo.availablefonts.html
    • /usr/share/doc/php-manual-en/cairo.availablesurfaces.html
    • /usr/share/doc/php-manual-en/cairo.configuration.html
    • /usr/share/doc/php-manual-en/cairo.constants.html
    • /usr/share/doc/php-manual-en/cairo.examples.html
    • /usr/share/doc/php-manual-en/cairo.installation.html
    • /usr/share/doc/php-manual-en/cairo.requirements.html
    • /usr/share/doc/php-manual-en/cairo.resources.html
    • /usr/share/doc/php-manual-en/cairo.setup.html
    • /usr/share/doc/php-manual-en/cairo.statustostring.html
    • /usr/share/doc/php-manual-en/cairo.version.html
    • /usr/share/doc/php-manual-en/cairo.versionstring.html
    • /usr/share/doc/php-manual-en/cairocontext.appendpath.html
    • /usr/share/doc/php-manual-en/cairocontext.arc.html
    • /usr/share/doc/php-manual-en/cairocontext.arcnegative.html
    • /usr/share/doc/php-manual-en/cairocontext.clip.html
    • /usr/share/doc/php-manual-en/cairocontext.clipextents.html
    • /usr/share/doc/php-manual-en/cairocontext.clippreserve.html
    • /usr/share/doc/php-manual-en/cairocontext.cliprectanglelist.html
    • /usr/share/doc/php-manual-en/cairocontext.closepath.html
    • /usr/share/doc/php-manual-en/cairocontext.construct.html
    • /usr/share/doc/php-manual-en/cairocontext.copypage.html
    • /usr/share/doc/php-manual-en/cairocontext.copypath.html
    • /usr/share/doc/php-manual-en/cairocontext.copypathflat.html
    • /usr/share/doc/php-manual-en/cairocontext.curveto.html
    • /usr/share/doc/php-manual-en/cairocontext.devicetouser.html
    • /usr/share/doc/php-manual-en/cairocontext.devicetouserdistance.html
    • /usr/share/doc/php-manual-en/cairocontext.fill.html
    • /usr/share/doc/php-manual-en/cairocontext.fillextents.html
    • /usr/share/doc/php-manual-en/cairocontext.fillpreserve.html
    • /usr/share/doc/php-manual-en/cairocontext.fontextents.html
    • /usr/share/doc/php-manual-en/cairocontext.getantialias.html
    • /usr/share/doc/php-manual-en/cairocontext.getcurrentpoint.html
    • /usr/share/doc/php-manual-en/cairocontext.getdash.html
    • /usr/share/doc/php-manual-en/cairocontext.getdashcount.html
    • /usr/share/doc/php-manual-en/cairocontext.getfillrule.html
    • /usr/share/doc/php-manual-en/cairocontext.getfontface.html
    • /usr/share/doc/php-manual-en/cairocontext.getfontmatrix.html
    • /usr/share/doc/php-manual-en/cairocontext.getfontoptions.html
    • /usr/share/doc/php-manual-en/cairocontext.getgrouptarget.html
    • /usr/share/doc/php-manual-en/cairocontext.getlinecap.html
    • /usr/share/doc/php-manual-en/cairocontext.getlinejoin.html
    • /usr/share/doc/php-manual-en/cairocontext.getlinewidth.html
    • /usr/share/doc/php-manual-en/cairocontext.getmatrix.html
    • /usr/share/doc/php-manual-en/cairocontext.getmiterlimit.html
    • /usr/share/doc/php-manual-en/cairocontext.getoperator.html
    • /usr/share/doc/php-manual-en/cairocontext.getscaledfont.html
    • /usr/share/doc/php-manual-en/cairocontext.getsource.html
    • /usr/share/doc/php-manual-en/cairocontext.gettarget.html
    • /usr/share/doc/php-manual-en/cairocontext.gettolerance.html
    • /usr/share/doc/php-manual-en/cairocontext.glyphpath.html
    • /usr/share/doc/php-manual-en/cairocontext.hascurrentpoint.html
    • /usr/share/doc/php-manual-en/cairocontext.identitymatrix.html
    • /usr/share/doc/php-manual-en/cairocontext.infill.html
    • /usr/share/doc/php-manual-en/cairocontext.instroke.html
    • /usr/share/doc/php-manual-en/cairocontext.lineto.html
    • /usr/share/doc/php-manual-en/cairocontext.mask.html
    • /usr/share/doc/php-manual-en/cairocontext.masksurface.html
    • /usr/share/doc/php-manual-en/cairocontext.moveto.html
    • /usr/share/doc/php-manual-en/cairocontext.newpath.html
    • /usr/share/doc/php-manual-en/cairocontext.newsubpath.html
    • /usr/share/doc/php-manual-en/cairocontext.paint.html
    • /usr/share/doc/php-manual-en/cairocontext.paintwithalpha.html
    • /usr/share/doc/php-manual-en/cairocontext.pathextents.html
    • /usr/share/doc/php-manual-en/cairocontext.popgroup.html
    • /usr/share/doc/php-manual-en/cairocontext.popgrouptosource.html
    • /usr/share/doc/php-manual-en/cairocontext.pushgroup.html
    • /usr/share/doc/php-manual-en/cairocontext.pushgroupwithcontent.html
    • /usr/share/doc/php-manual-en/cairocontext.rectangle.html
    • /usr/share/doc/php-manual-en/cairocontext.relcurveto.html
    • /usr/share/doc/php-manual-en/cairocontext.rellineto.html
    • /usr/share/doc/php-manual-en/cairocontext.relmoveto.html
    • /usr/share/doc/php-manual-en/cairocontext.resetclip.html
    • /usr/share/doc/php-manual-en/cairocontext.restore.html
    • /usr/share/doc/php-manual-en/cairocontext.rotate.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/cairocontext.scale.html
    • /usr/share/doc/php-manual-en/cairocontext.selectfontface.html
    • /usr/share/doc/php-manual-en/cairocontext.setantialias.html
    • /usr/share/doc/php-manual-en/cairocontext.setdash.html
    • /usr/share/doc/php-manual-en/cairocontext.setfillrule.html
    • /usr/share/doc/php-manual-en/cairocontext.setfontface.html
    • /usr/share/doc/php-manual-en/cairocontext.setfontmatrix.html
    • /usr/share/doc/php-manual-en/cairocontext.setfontoptions.html
    • /usr/share/doc/php-manual-en/cairocontext.setfontsize.html
    • /usr/share/doc/php-manual-en/cairocontext.setlinecap.html
    • /usr/share/doc/php-manual-en/cairocontext.setlinejoin.html
    • /usr/share/doc/php-manual-en/cairocontext.setlinewidth.html
    • /usr/share/doc/php-manual-en/cairocontext.setmatrix.html
    • /usr/share/doc/php-manual-en/cairocontext.setmiterlimit.html
    • /usr/share/doc/php-manual-en/cairocontext.setoperator.html
    • /usr/share/doc/php-manual-en/cairocontext.setscaledfont.html
    • /usr/share/doc/php-manual-en/cairocontext.setsource.html
    • /usr/share/doc/php-manual-en/cairocontext.setsourcergb.html
    • /usr/share/doc/php-manual-en/cairocontext.setsourcergba.html
    • /usr/share/doc/php-manual-en/cairocontext.setsourcesurface.html
    • /usr/share/doc/php-manual-en/cairocontext.settolerance.html
    • /usr/share/doc/php-manual-en/cairocontext.showpage.html
    • /usr/share/doc/php-manual-en/cairocontext.showtext.html
    • /usr/share/doc/php-manual-en/cairocontext.status.html
    • /usr/share/doc/php-manual-en/cairocontext.stroke.html
    • /usr/share/doc/php-manual-en/cairocontext.strokeextents.html
    • /usr/share/doc/php-manual-en/cairocontext.strokepreserve.html
    • /usr/share/doc/php-manual-en/cairocontext.textextents.html
    • /usr/share/doc/php-manual-en/cairocontext.textpath.html
    • /usr/share/doc/php-manual-en/cairocontext.transform.html
    • /usr/share/doc/php-manual-en/cairocontext.translate.html
    • /usr/share/doc/php-manual-en/cairocontext.usertodevice.html
    • /usr/share/doc/php-manual-en/cairocontext.usertodevicedistance.html
    • /usr/share/doc/php-manual-en/cairofontface.construct.html
    • /usr/share/doc/php-manual-en/cairofontface.gettype.html
    • /usr/share/doc/php-manual-en/cairofontface.status.html
    • /usr/share/doc/php-manual-en/cairofontoptions.construct.html
    • /usr/share/doc/php-manual-en/cairofontoptions.equal.html
    • /usr/share/doc/php-manual-en/cairofontoptions.getantialias.html
    • /usr/share/doc/php-manual-en/cairofontoptions.gethintmetrics.html
    • /usr/share/doc/php-manual-en/cairofontoptions.gethintstyle.html
    • /usr/share/doc/php-manual-en/cairofontoptions.getsubpixelorder.html
    • /usr/share/doc/php-manual-en/cairofontoptions.hash.html
    • /usr/share/doc/php-manual-en/cairofontoptions.merge.html
    • /usr/share/doc/php-manual-en/cairofontoptions.setantialias.html
    • /usr/share/doc/php-manual-en/cairofontoptions.sethintmetrics.html
    • /usr/share/doc/php-manual-en/cairofontoptions.sethintstyle.html
    • /usr/share/doc/php-manual-en/cairofontoptions.setsubpixelorder.html
    • /usr/share/doc/php-manual-en/cairofontoptions.status.html
    • /usr/share/doc/php-manual-en/cairoformat.strideforwidth.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.addcolorstoprgb.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.addcolorstoprgba.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.getcolorstopcount.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.getcolorstoprgba.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.getextend.html
    • /usr/share/doc/php-manual-en/cairogradientpattern.setextend.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.construct.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.createfordata.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.createfrompng.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.getdata.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.getformat.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.getheight.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.getstride.html
    • /usr/share/doc/php-manual-en/cairoimagesurface.getwidth.html
    • /usr/share/doc/php-manual-en/cairolineargradient.construct.html
    • /usr/share/doc/php-manual-en/cairolineargradient.getpoints.html
    • /usr/share/doc/php-manual-en/cairomatrix.construct.html
    • /usr/share/doc/php-manual-en/cairomatrix.initidentity.html
    • /usr/share/doc/php-manual-en/cairomatrix.initrotate.html
    • /usr/share/doc/php-manual-en/cairomatrix.initscale.html
    • /usr/share/doc/php-manual-en/cairomatrix.inittranslate.html
    • /usr/share/doc/php-manual-en/cairomatrix.invert.html
    • /usr/share/doc/php-manual-en/cairomatrix.multiply.html
    • /usr/share/doc/php-manual-en/cairomatrix.rotate.html
    • /usr/share/doc/php-manual-en/cairomatrix.scale.html
    • /usr/share/doc/php-manual-en/cairomatrix.transformdistance.html
    • /usr/share/doc/php-manual-en/cairomatrix.transformpoint.html
    • /usr/share/doc/php-manual-en/cairomatrix.translate.html
    • /usr/share/doc/php-manual-en/cairopattern.construct.html
    • /usr/share/doc/php-manual-en/cairopattern.getmatrix.html
    • /usr/share/doc/php-manual-en/cairopattern.gettype.html
    • /usr/share/doc/php-manual-en/cairopattern.setmatrix.html
    • /usr/share/doc/php-manual-en/cairopattern.status.html
    • /usr/share/doc/php-manual-en/cairopdfsurface.construct.html
    • /usr/share/doc/php-manual-en/cairopdfsurface.setsize.html
    • /usr/share/doc/php-manual-en/cairopssurface.construct.html
    • /usr/share/doc/php-manual-en/cairopssurface.dscbeginpagesetup.html
    • /usr/share/doc/php-manual-en/cairopssurface.dscbeginsetup.html
    • /usr/share/doc/php-manual-en/cairopssurface.dsccomment.html
    • /usr/share/doc/php-manual-en/cairopssurface.geteps.html
    • /usr/share/doc/php-manual-en/cairopssurface.getlevels.html
    • /usr/share/doc/php-manual-en/cairopssurface.leveltostring.html
    • /usr/share/doc/php-manual-en/cairopssurface.restricttolevel.html
    • /usr/share/doc/php-manual-en/cairopssurface.seteps.html
    • /usr/share/doc/php-manual-en/cairopssurface.setsize.html
    • /usr/share/doc/php-manual-en/cairoradialgradient.construct.html
    • /usr/share/doc/php-manual-en/cairoradialgradient.getcircles.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.construct.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.extents.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.getctm.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.getfontface.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.getfontmatrix.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.getfontoptions.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.getscalematrix.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.gettype.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.glyphextents.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.status.html
    • /usr/share/doc/php-manual-en/cairoscaledfont.textextents.html
    • /usr/share/doc/php-manual-en/cairosolidpattern.construct.html
    • /usr/share/doc/php-manual-en/cairosolidpattern.getrgba.html
    • /usr/share/doc/php-manual-en/cairosurface.construct.html
    • /usr/share/doc/php-manual-en/cairosurface.copypage.html
    • /usr/share/doc/php-manual-en/cairosurface.createsimilar.html
    • /usr/share/doc/php-manual-en/cairosurface.finish.html
    • /usr/share/doc/php-manual-en/cairosurface.flush.html
    • /usr/share/doc/php-manual-en/cairosurface.getcontent.html
    • /usr/share/doc/php-manual-en/cairosurface.getdeviceoffset.html
    • /usr/share/doc/php-manual-en/cairosurface.getfontoptions.html
    • /usr/share/doc/php-manual-en/cairosurface.gettype.html
    • /usr/share/doc/php-manual-en/cairosurface.markdirty.html
    • /usr/share/doc/php-manual-en/cairosurface.markdirtyrectangle.html
    • /usr/share/doc/php-manual-en/cairosurface.setdeviceoffset.html
    • /usr/share/doc/php-manual-en/cairosurface.setfallbackresolution.html
    • /usr/share/doc/php-manual-en/cairosurface.showpage.html
    • /usr/share/doc/php-manual-en/cairosurface.status.html
    • /usr/share/doc/php-manual-en/cairosurface.writetopng.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.construct.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.getextend.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.getfilter.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.getsurface.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.setextend.html
    • /usr/share/doc/php-manual-en/cairosurfacepattern.setfilter.html
    • /usr/share/doc/php-manual-en/cairosvgsurface.construct.html
    • /usr/share/doc/php-manual-en/cairosvgsurface.getversions.html
    • /usr/share/doc/php-manual-en/cairosvgsurface.restricttoversion.html
    • /usr/share/doc/php-manual-en/cairosvgsurface.versiontostring.html
    • /usr/share/doc/php-manual-en/calendar.configuration.html
    • /usr/share/doc/php-manual-en/calendar.constants.html
    • /usr/share/doc/php-manual-en/calendar.installation.html
    • /usr/share/doc/php-manual-en/calendar.requirements.html
    • /usr/share/doc/php-manual-en/calendar.resources.html
    • /usr/share/doc/php-manual-en/calendar.setup.html
    • /usr/share/doc/php-manual-en/callbackfilteriterator.accept.html
    • /usr/share/doc/php-manual-en/callbackfilteriterator.construct.html
    • /usr/share/doc/php-manual-en/cc.license.html
    • /usr/share/doc/php-manual-en/changelog.misc.html
    • /usr/share/doc/php-manual-en/changelog.mongo.html
    • /usr/share/doc/php-manual-en/changelog.mysql.html
    • /usr/share/doc/php-manual-en/changelog.mysqli.html
    • /usr/share/doc/php-manual-en/changelog.strings.html
    • /usr/share/doc/php-manual-en/chdb.configuration.html
    • /usr/share/doc/php-manual-en/chdb.constants.html
    • /usr/share/doc/php-manual-en/chdb.construct.html
    • /usr/share/doc/php-manual-en/chdb.examples.html
    • /usr/share/doc/php-manual-en/chdb.get.html
    • /usr/share/doc/php-manual-en/chdb.installation.html
    • /usr/share/doc/php-manual-en/chdb.requirements.html
    • /usr/share/doc/php-manual-en/chdb.resources.html
    • /usr/share/doc/php-manual-en/chdb.setup.html
    • /usr/share/doc/php-manual-en/class.OCI-Collection.html
    • /usr/share/doc/php-manual-en/class.OCI-Lob.html
    • /usr/share/doc/php-manual-en/class.amqpchannel.html
    • /usr/share/doc/php-manual-en/class.amqpconnection.html
    • /usr/share/doc/php-manual-en/class.amqpenvelope.html
    • /usr/share/doc/php-manual-en/class.amqpexchange.html
    • /usr/share/doc/php-manual-en/class.amqpqueue.html
    • /usr/share/doc/php-manual-en/class.apciterator.html
    • /usr/share/doc/php-manual-en/class.appenditerator.html
    • /usr/share/doc/php-manual-en/class.arrayaccess.html
    • /usr/share/doc/php-manual-en/class.arrayiterator.html
    • /usr/share/doc/php-manual-en/class.arrayobject.html
    • /usr/share/doc/php-manual-en/class.badfunctioncallexception.html
    • /usr/share/doc/php-manual-en/class.badmethodcallexception.html
    • /usr/share/doc/php-manual-en/class.cachingiterator.html
    • /usr/share/doc/php-manual-en/class.cairo.html
    • /usr/share/doc/php-manual-en/class.cairoantialias.html
    • /usr/share/doc/php-manual-en/class.cairocontent.html
    • /usr/share/doc/php-manual-en/class.cairocontext.html
    • /usr/share/doc/php-manual-en/class.cairoexception.html
    • /usr/share/doc/php-manual-en/class.cairoextend.html
    • /usr/share/doc/php-manual-en/class.cairofillrule.html
    • /usr/share/doc/php-manual-en/class.cairofilter.html
    • /usr/share/doc/php-manual-en/class.cairofontface.html
    • /usr/share/doc/php-manual-en/class.cairofontoptions.html
    • /usr/share/doc/php-manual-en/class.cairofontslant.html
    • /usr/share/doc/php-manual-en/class.cairofonttype.html
    • /usr/share/doc/php-manual-en/class.cairofontweight.html
    • /usr/share/doc/php-manual-en/class.cairoformat.html
    • /usr/share/doc/php-manual-en/class.cairogradientpattern.html
    • /usr/share/doc/php-manual-en/class.cairohintmetrics.html
    • /usr/share/doc/php-manual-en/class.cairohintstyle.html
    • /usr/share/doc/php-manual-en/class.cairoimagesurface.html
    • /usr/share/doc/php-manual-en/class.cairolineargradient.html
    • /usr/share/doc/php-manual-en/class.cairolinecap.html
    • /usr/share/doc/php-manual-en/class.cairolinejoin.html
    • /usr/share/doc/php-manual-en/class.cairomatrix.html
    • /usr/share/doc/php-manual-en/class.cairooperator.html
    • /usr/share/doc/php-manual-en/class.cairopath.html
    • /usr/share/doc/php-manual-en/class.cairopattern.html
    • /usr/share/doc/php-manual-en/class.cairopatterntype.html
    • /usr/share/doc/php-manual-en/class.cairopdfsurface.html
    • /usr/share/doc/php-manual-en/class.cairopslevel.html
    • /usr/share/doc/php-manual-en/class.cairopssurface.html
    • /usr/share/doc/php-manual-en/class.cairoradialgradient.html
    • /usr/share/doc/php-manual-en/class.cairoscaledfont.html
    • /usr/share/doc/php-manual-en/class.cairosolidpattern.html
    • /usr/share/doc/php-manual-en/class.cairostatus.html
    • /usr/share/doc/php-manual-en/class.cairosubpixelorder.html
    • /usr/share/doc/php-manual-en/class.cairosurface.html
    • /usr/share/doc/php-manual-en/class.cairosurfacepattern.html
    • /usr/share/doc/php-manual-en/class.cairosurfacetype.html
    • /usr/share/doc/php-manual-en/class.cairosvgsurface.html
    • /usr/share/doc/php-manual-en/class.cairosvgversion.html
    • /usr/share/doc/php-manual-en/class.cairotoyfontface.html
    • /usr/share/doc/php-manual-en/class.callbackfilteriterator.html
    • /usr/share/doc/php-manual-en/class.chdb.html
    • /usr/share/doc/php-manual-en/class.closure.html
    • /usr/share/doc/php-manual-en/class.collator.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/class.cond.html
    • /usr/share/doc/php-manual-en/class.countable.html
    • /usr/share/doc/php-manual-en/class.curlfile.html
    • /usr/share/doc/php-manual-en/class.dateinterval.html
    • /usr/share/doc/php-manual-en/class.dateperiod.html
    • /usr/share/doc/php-manual-en/class.datetime.html
    • /usr/share/doc/php-manual-en/class.datetimeimmutable.html
    • /usr/share/doc/php-manual-en/class.datetimeinterface.html
    • /usr/share/doc/php-manual-en/class.datetimezone.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/class.directoryiterator.html
    • /usr/share/doc/php-manual-en/class.domainexception.html
    • /usr/share/doc/php-manual-en/class.domattr.html
    • /usr/share/doc/php-manual-en/class.domcdatasection.html
    • /usr/share/doc/php-manual-en/class.domcharacterdata.html
    • /usr/share/doc/php-manual-en/class.domcomment.html
    • /usr/share/doc/php-manual-en/class.domdocument.html
    • /usr/share/doc/php-manual-en/class.domdocumentfragment.html
    • /usr/share/doc/php-manual-en/class.domdocumenttype.html
    • /usr/share/doc/php-manual-en/class.domelement.html
    • /usr/share/doc/php-manual-en/class.domentity.html
    • /usr/share/doc/php-manual-en/class.domentityreference.html
    • /usr/share/doc/php-manual-en/class.domexception.html
    • /usr/share/doc/php-manual-en/class.domimplementation.html
    • /usr/share/doc/php-manual-en/class.domnamednodemap.html
    • /usr/share/doc/php-manual-en/class.domnode.html
    • /usr/share/doc/php-manual-en/class.domnodelist.html
    • /usr/share/doc/php-manual-en/class.domnotation.html
    • /usr/share/doc/php-manual-en/class.domprocessinginstruction.html
    • /usr/share/doc/php-manual-en/class.domtext.html
    • /usr/share/doc/php-manual-en/class.domxpath.html
    • /usr/share/doc/php-manual-en/class.dotnet.html
    • /usr/share/doc/php-manual-en/class.emptyiterator.html
    • /usr/share/doc/php-manual-en/class.errorexception.html
    • /usr/share/doc/php-manual-en/class.ev.html
    • /usr/share/doc/php-manual-en/class.evcheck.html
    • /usr/share/doc/php-manual-en/class.evchild.html
    • /usr/share/doc/php-manual-en/class.evembed.html
    • /usr/share/doc/php-manual-en/class.event.html
    • /usr/share/doc/php-manual-en/class.eventbase.html
    • /usr/share/doc/php-manual-en/class.eventbuffer.html
    • /usr/share/doc/php-manual-en/class.eventbufferevent.html
    • /usr/share/doc/php-manual-en/class.eventconfig.html
    • /usr/share/doc/php-manual-en/class.eventdnsbase.html
    • /usr/share/doc/php-manual-en/class.eventhttp.html
    • /usr/share/doc/php-manual-en/class.eventhttpconnection.html
    • /usr/share/doc/php-manual-en/class.eventhttprequest.html
    • /usr/share/doc/php-manual-en/class.eventlistener.html
    • /usr/share/doc/php-manual-en/class.eventsslcontext.html
    • /usr/share/doc/php-manual-en/class.eventutil.html
    • /usr/share/doc/php-manual-en/class.evfork.html
    • /usr/share/doc/php-manual-en/class.evidle.html
    • /usr/share/doc/php-manual-en/class.evio.html
    • /usr/share/doc/php-manual-en/class.evloop.html
    • /usr/share/doc/php-manual-en/class.evperiodic.html
    • /usr/share/doc/php-manual-en/class.evprepare.html
    • /usr/share/doc/php-manual-en/class.evsignal.html
    • /usr/share/doc/php-manual-en/class.evstat.html
    • /usr/share/doc/php-manual-en/class.evtimer.html
    • /usr/share/doc/php-manual-en/class.evwatcher.html
    • /usr/share/doc/php-manual-en/class.exception.html
    • /usr/share/doc/php-manual-en/class.fannconnection.html
    • /usr/share/doc/php-manual-en/class.filesystemiterator.html
    • /usr/share/doc/php-manual-en/class.filteriterator.html
    • /usr/share/doc/php-manual-en/class.gearmanclient.html
    • /usr/share/doc/php-manual-en/class.gearmanexception.html
    • /usr/share/doc/php-manual-en/class.gearmanjob.html
    • /usr/share/doc/php-manual-en/class.gearmantask.html
    • /usr/share/doc/php-manual-en/class.gearmanworker.html
    • /usr/share/doc/php-manual-en/class.gender.html
    • /usr/share/doc/php-manual-en/class.generator.html
    • /usr/share/doc/php-manual-en/class.globiterator.html
    • /usr/share/doc/php-manual-en/class.gmagick.html
    • /usr/share/doc/php-manual-en/class.gmagickdraw.html
    • /usr/share/doc/php-manual-en/class.gmagickpixel.html
    • /usr/share/doc/php-manual-en/class.haruannotation.html
    • /usr/share/doc/php-manual-en/class.harudestination.html
    • /usr/share/doc/php-manual-en/class.harudoc.html
    • /usr/share/doc/php-manual-en/class.haruencoder.html
    • /usr/share/doc/php-manual-en/class.haruexception.html
    • /usr/share/doc/php-manual-en/class.harufont.html
    • /usr/share/doc/php-manual-en/class.haruimage.html
    • /usr/share/doc/php-manual-en/class.haruoutline.html
    • /usr/share/doc/php-manual-en/class.harupage.html
    • /usr/share/doc/php-manual-en/class.httpdeflatestream.html
    • /usr/share/doc/php-manual-en/class.httpinflatestream.html
    • /usr/share/doc/php-manual-en/class.httpmessage.html
    • /usr/share/doc/php-manual-en/class.httpquerystring.html
    • /usr/share/doc/php-manual-en/class.httprequest.html
    • /usr/share/doc/php-manual-en/class.httprequestpool.html
    • /usr/share/doc/php-manual-en/class.httpresponse.html
    • /usr/share/doc/php-manual-en/class.imagick.html
    • /usr/share/doc/php-manual-en/class.imagickdraw.html
    • /usr/share/doc/php-manual-en/class.imagickpixel.html
    • /usr/share/doc/php-manual-en/class.imagickpixeliterator.html
    • /usr/share/doc/php-manual-en/class.infiniteiterator.html
    • /usr/share/doc/php-manual-en/class.intlbreakiterator.html
    • /usr/share/doc/php-manual-en/class.intlcalendar.html
    • /usr/share/doc/php-manual-en/class.intlcodepointbreakiterator.html
    • /usr/share/doc/php-manual-en/class.intldateformatter.html
    • /usr/share/doc/php-manual-en/class.intlexception.html
    • /usr/share/doc/php-manual-en/class.intliterator.html
    • /usr/share/doc/php-manual-en/class.intlpartsiterator.html
    • /usr/share/doc/php-manual-en/class.intlrulebasedbreakiterator.html
    • /usr/share/doc/php-manual-en/class.intltimezone.html
    • /usr/share/doc/php-manual-en/class.invalidargumentexception.html
    • /usr/share/doc/php-manual-en/class.iterator.html
    • /usr/share/doc/php-manual-en/class.iteratoraggregate.html
    • /usr/share/doc/php-manual-en/class.iteratoriterator.html
    • /usr/share/doc/php-manual-en/class.jsonserializable.html
    • /usr/share/doc/php-manual-en/class.judy.html
    • /usr/share/doc/php-manual-en/class.ktaglib-id3v2-attachedpictureframe.html
    • /usr/share/doc/php-manual-en/class.ktaglib-id3v2-frame.html
    • /usr/share/doc/php-manual-en/class.ktaglib-id3v2-tag.html
    • /usr/share/doc/php-manual-en/class.ktaglib-mpeg-audioproperties.html
    • /usr/share/doc/php-manual-en/class.ktaglib-mpeg-file.html
    • /usr/share/doc/php-manual-en/class.ktaglib-tag.html
    • /usr/share/doc/php-manual-en/class.lapack.html
    • /usr/share/doc/php-manual-en/class.lapackexception.html
    • /usr/share/doc/php-manual-en/class.lengthexception.html
    • /usr/share/doc/php-manual-en/class.libxmlerror.html
    • /usr/share/doc/php-manual-en/class.limititerator.html
    • /usr/share/doc/php-manual-en/class.locale.html
    • /usr/share/doc/php-manual-en/class.logicexception.html
    • /usr/share/doc/php-manual-en/class.lua.html
    • /usr/share/doc/php-manual-en/class.luaclosure.html
    • /usr/share/doc/php-manual-en/class.memcache.html
    • /usr/share/doc/php-manual-en/class.memcached.html
    • /usr/share/doc/php-manual-en/class.memcachedexception.html
    • /usr/share/doc/php-manual-en/class.messageformatter.html
    • /usr/share/doc/php-manual-en/class.mongo.html
    • /usr/share/doc/php-manual-en/class.mongobindata.html
    • /usr/share/doc/php-manual-en/class.mongoclient.html
    • /usr/share/doc/php-manual-en/class.mongocode.html
    • /usr/share/doc/php-manual-en/class.mongocollection.html
    • /usr/share/doc/php-manual-en/class.mongoconnectionexception.html
    • /usr/share/doc/php-manual-en/class.mongocursor.html
    • /usr/share/doc/php-manual-en/class.mongocursorexception.html
    • /usr/share/doc/php-manual-en/class.mongocursortimeoutexception.html
    • /usr/share/doc/php-manual-en/class.mongodate.html
    • /usr/share/doc/php-manual-en/class.mongodb.html
    • /usr/share/doc/php-manual-en/class.mongodbref.html
    • /usr/share/doc/php-manual-en/class.mongoexception.html
    • /usr/share/doc/php-manual-en/class.mongogridfs.html
    • /usr/share/doc/php-manual-en/class.mongogridfscursor.html
    • /usr/share/doc/php-manual-en/class.mongogridfsexception.html
    • /usr/share/doc/php-manual-en/class.mongogridfsfile.html
    • /usr/share/doc/php-manual-en/class.mongoid.html
    • /usr/share/doc/php-manual-en/class.mongoint32.html
    • /usr/share/doc/php-manual-en/class.mongoint64.html
    • /usr/share/doc/php-manual-en/class.mongolog.html
    • /usr/share/doc/php-manual-en/class.mongomaxkey.html
    • /usr/share/doc/php-manual-en/class.mongominkey.html
    • /usr/share/doc/php-manual-en/class.mongopool.html
    • /usr/share/doc/php-manual-en/class.mongoregex.html
    • /usr/share/doc/php-manual-en/class.mongoresultexception.html
    • /usr/share/doc/php-manual-en/class.mongotimestamp.html
    • /usr/share/doc/php-manual-en/class.multipleiterator.html
    • /usr/share/doc/php-manual-en/class.mutex.html
    • /usr/share/doc/php-manual-en/class.mysqli-driver.html
    • /usr/share/doc/php-manual-en/class.mysqli-result.html
    • /usr/share/doc/php-manual-en/class.mysqli-sql-exception.html
    • /usr/share/doc/php-manual-en/class.mysqli-stmt.html
    • /usr/share/doc/php-manual-en/class.mysqli-warning.html
    • /usr/share/doc/php-manual-en/class.mysqli.html
    • /usr/share/doc/php-manual-en/class.mysqlnduhconnection.html
    • /usr/share/doc/php-manual-en/class.mysqlnduhpreparedstatement.html
    • /usr/share/doc/php-manual-en/class.norewinditerator.html
    • /usr/share/doc/php-manual-en/class.normalizer.html
    • /usr/share/doc/php-manual-en/class.numberformatter.html
    • /usr/share/doc/php-manual-en/class.oauth.html
    • /usr/share/doc/php-manual-en/class.oauthexception.html
    • /usr/share/doc/php-manual-en/class.oauthprovider.html
    • /usr/share/doc/php-manual-en/class.outeriterator.html
    • /usr/share/doc/php-manual-en/class.outofboundsexception.html
    • /usr/share/doc/php-manual-en/class.outofrangeexception.html
    • /usr/share/doc/php-manual-en/class.overflowexception.html
    • /usr/share/doc/php-manual-en/class.parentiterator.html
    • /usr/share/doc/php-manual-en/class.pdo.html
    • /usr/share/doc/php-manual-en/class.pdoexception.html
    • /usr/share/doc/php-manual-en/class.pdostatement.html
    • /usr/share/doc/php-manual-en/class.phar.html
    • /usr/share/doc/php-manual-en/class.phardata.html
    • /usr/share/doc/php-manual-en/class.pharexception.html
    • /usr/share/doc/php-manual-en/class.pharfileinfo.html
    • /usr/share/doc/php-manual-en/class.php-user-filter.html
    • /usr/share/doc/php-manual-en/class.quickhashinthash.html
    • /usr/share/doc/php-manual-en/class.quickhashintset.html
    • /usr/share/doc/php-manual-en/class.quickhashintstringhash.html
    • /usr/share/doc/php-manual-en/class.quickhashstringinthash.html
    • /usr/share/doc/php-manual-en/class.rangeexception.html
    • /usr/share/doc/php-manual-en/class.rararchive.html
    • /usr/share/doc/php-manual-en/class.rarentry.html
    • /usr/share/doc/php-manual-en/class.rarexception.html
    • /usr/share/doc/php-manual-en/class.recursivearrayiterator.html
    • /usr/share/doc/php-manual-en/class.recursivecachingiterator.html
    • /usr/share/doc/php-manual-en/class.recursivecallbackfilteriterator.html
    • /usr/share/doc/php-manual-en/class.recursivedirectoryiterator.html
    • /usr/share/doc/php-manual-en/class.recursivefilteriterator.html
    • /usr/share/doc/php-manual-en/class.recursiveiterator.html
    • /usr/share/doc/php-manual-en/class.recursiveiteratoriterator.html
    • /usr/share/doc/php-manual-en/class.recursiveregexiterator.html
    • /usr/share/doc/php-manual-en/class.recursivetreeiterator.html
    • /usr/share/doc/php-manual-en/class.reflection.html
    • /usr/share/doc/php-manual-en/class.reflectionclass.html
    • /usr/share/doc/php-manual-en/class.reflectionexception.html
    • /usr/share/doc/php-manual-en/class.reflectionextension.html
    • /usr/share/doc/php-manual-en/class.reflectionfunction.html
    • /usr/share/doc/php-manual-en/class.reflectionfunctionabstract.html
    • /usr/share/doc/php-manual-en/class.reflectionmethod.html
    • /usr/share/doc/php-manual-en/class.reflectionobject.html
    • /usr/share/doc/php-manual-en/class.reflectionparameter.html
    • /usr/share/doc/php-manual-en/class.reflectionproperty.html
    • /usr/share/doc/php-manual-en/class.reflectionzendextension.html
    • /usr/share/doc/php-manual-en/class.reflector.html
    • /usr/share/doc/php-manual-en/class.regexiterator.html
    • /usr/share/doc/php-manual-en/class.resourcebundle.html
    • /usr/share/doc/php-manual-en/class.rrdcreator.html
    • /usr/share/doc/php-manual-en/class.rrdgraph.html
    • /usr/share/doc/php-manual-en/class.rrdupdater.html
    • /usr/share/doc/php-manual-en/class.runtimeexception.html
    • /usr/share/doc/php-manual-en/class.seekableiterator.html
    • /usr/share/doc/php-manual-en/class.serializable.html
    • /usr/share/doc/php-manual-en/class.sessionhandler.html
    • /usr/share/doc/php-manual-en/class.sessionhandlerinterface.html
    • /usr/share/doc/php-manual-en/class.simplexmlelement.html
    • /usr/share/doc/php-manual-en/class.simplexmliterator.html
    • /usr/share/doc/php-manual-en/class.snmp.html
    • /usr/share/doc/php-manual-en/class.snmpexception.html
    • /usr/share/doc/php-manual-en/class.soapclient.html
    • /usr/share/doc/php-manual-en/class.soapfault.html
    • /usr/share/doc/php-manual-en/class.soapheader.html
    • /usr/share/doc/php-manual-en/class.soapparam.html
    • /usr/share/doc/php-manual-en/class.soapserver.html
    • /usr/share/doc/php-manual-en/class.soapvar.html
    • /usr/share/doc/php-manual-en/class.solrclient.html
    • /usr/share/doc/php-manual-en/class.solrclientexception.html
    • /usr/share/doc/php-manual-en/class.solrdocument.html
    • /usr/share/doc/php-manual-en/class.solrdocumentfield.html
    • /usr/share/doc/php-manual-en/class.solrexception.html
    • /usr/share/doc/php-manual-en/class.solrgenericresponse.html
    • /usr/share/doc/php-manual-en/class.solrillegalargumentexception.html
    • /usr/share/doc/php-manual-en/class.solrillegaloperationexception.html
    • /usr/share/doc/php-manual-en/class.solrinputdocument.html
    • /usr/share/doc/php-manual-en/class.solrmodifiableparams.html
    • /usr/share/doc/php-manual-en/class.solrobject.html
    • /usr/share/doc/php-manual-en/class.solrparams.html
    • /usr/share/doc/php-manual-en/class.solrpingresponse.html
    • /usr/share/doc/php-manual-en/class.solrquery.html
    • /usr/share/doc/php-manual-en/class.solrqueryresponse.html
    • /usr/share/doc/php-manual-en/class.solrresponse.html
    • /usr/share/doc/php-manual-en/class.solrupdateresponse.html
    • /usr/share/doc/php-manual-en/class.solrutils.html
    • /usr/share/doc/php-manual-en/class.sphinxclient.html
    • /usr/share/doc/php-manual-en/class.splbool.html
    • /usr/share/doc/php-manual-en/class.spldoublylinkedlist.html
    • /usr/share/doc/php-manual-en/class.splenum.html
    • /usr/share/doc/php-manual-en/class.splfileinfo.html
    • /usr/share/doc/php-manual-en/class.splfileobject.html
    • /usr/share/doc/php-manual-en/class.splfixedarray.html
    • /usr/share/doc/php-manual-en/class.splfloat.html
    • /usr/share/doc/php-manual-en/class.splheap.html
    • /usr/share/doc/php-manual-en/class.splint.html
    • /usr/share/doc/php-manual-en/class.splmaxheap.html
    • /usr/share/doc/php-manual-en/class.splminheap.html
    • /usr/share/doc/php-manual-en/class.splobjectstorage.html
    • /usr/share/doc/php-manual-en/class.splobserver.html
    • /usr/share/doc/php-manual-en/class.splpriorityqueue.html
    • /usr/share/doc/php-manual-en/class.splqueue.html
    • /usr/share/doc/php-manual-en/class.splstack.html
    • /usr/share/doc/php-manual-en/class.splstring.html
    • /usr/share/doc/php-manual-en/class.splsubject.html
    • /usr/share/doc/php-manual-en/class.spltempfileobject.html
    • /usr/share/doc/php-manual-en/class.spltype.html
    • /usr/share/doc/php-manual-en/class.spoofchecker.html
    • /usr/share/doc/php-manual-en/class.sqlite3.html
    • /usr/share/doc/php-manual-en/class.sqlite3result.html
    • /usr/share/doc/php-manual-en/class.sqlite3stmt.html
    • /usr/share/doc/php-manual-en/class.stackable.html
    • /usr/share/doc/php-manual-en/class.stomp.html
    • /usr/share/doc/php-manual-en/class.stompexception.html
    • /usr/share/doc/php-manual-en/class.stompframe.html
    • /usr/share/doc/php-manual-en/class.streamwrapper.html
    • /usr/share/doc/php-manual-en/class.svm.html
    • /usr/share/doc/php-manual-en/class.svmmodel.html
    • /usr/share/doc/php-manual-en/class.swfaction.html
    • /usr/share/doc/php-manual-en/class.swfbitmap.html
    • /usr/share/doc/php-manual-en/class.swfbutton.html
    • /usr/share/doc/php-manual-en/class.swfdisplayitem.html
    • /usr/share/doc/php-manual-en/class.swffill.html
    • /usr/share/doc/php-manual-en/class.swffont.html
    • /usr/share/doc/php-manual-en/class.swffontchar.html
    • /usr/share/doc/php-manual-en/class.swfgradient.html
    • /usr/share/doc/php-manual-en/class.swfmorph.html
    • /usr/share/doc/php-manual-en/class.swfmovie.html
    • /usr/share/doc/php-manual-en/class.swfprebuiltclip.html
    • /usr/share/doc/php-manual-en/class.swfshape.html
    • /usr/share/doc/php-manual-en/class.swfsound.html
    • /usr/share/doc/php-manual-en/class.swfsoundinstance.html
    • /usr/share/doc/php-manual-en/class.swfsprite.html
    • /usr/share/doc/php-manual-en/class.swftext.html
    • /usr/share/doc/php-manual-en/class.swftextfield.html
    • /usr/share/doc/php-manual-en/class.swfvideostream.html
    • /usr/share/doc/php-manual-en/class.thread.html
    • /usr/share/doc/php-manual-en/class.tidy.html
    • /usr/share/doc/php-manual-en/class.tidynode.html
    • /usr/share/doc/php-manual-en/class.tokyotyrant.html
    • /usr/share/doc/php-manual-en/class.tokyotyrantexception.html
    • /usr/share/doc/php-manual-en/class.tokyotyrantiterator.html
    • /usr/share/doc/php-manual-en/class.tokyotyrantquery.html
    • /usr/share/doc/php-manual-en/class.tokyotyranttable.html
    • /usr/share/doc/php-manual-en/class.transliterator.html
    • /usr/share/doc/php-manual-en/class.traversable.html
    • /usr/share/doc/php-manual-en/class.uconverter.html
    • /usr/share/doc/php-manual-en/class.underflowexception.html
    • /usr/share/doc/php-manual-en/class.unexpectedvalueexception.html
    • /usr/share/doc/php-manual-en/class.v8js.html
    • /usr/share/doc/php-manual-en/class.v8jsexception.html
    • /usr/share/doc/php-manual-en/class.variant.html
    • /usr/share/doc/php-manual-en/class.varnishadmin.html
    • /usr/share/doc/php-manual-en/class.varnishlog.html
    • /usr/share/doc/php-manual-en/class.varnishstat.html
    • /usr/share/doc/php-manual-en/class.weakmap.html
    • /usr/share/doc/php-manual-en/class.weakref.html
    • /usr/share/doc/php-manual-en/class.worker.html
    • /usr/share/doc/php-manual-en/class.xmldiff-base.html
    • /usr/share/doc/php-manual-en/class.xmldiff-dom.html
    • /usr/share/doc/php-manual-en/class.xmldiff-file.html
    • /usr/share/doc/php-manual-en/class.xmldiff-memory.html
    • /usr/share/doc/php-manual-en/class.xmlreader.html
    • /usr/share/doc/php-manual-en/class.xsltprocessor.html
    • /usr/share/doc/php-manual-en/class.yaf-action-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-application.html
    • /usr/share/doc/php-manual-en/class.yaf-bootstrap-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-config-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-config-ini.html
    • /usr/share/doc/php-manual-en/class.yaf-config-simple.html
    • /usr/share/doc/php-manual-en/class.yaf-controller-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-dispatcher.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-dispatchfailed.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-loadfailed-action.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-loadfailed-controller.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-loadfailed-module.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-loadfailed-view.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-loadfailed.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-routerfailed.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-startuperror.html
    • /usr/share/doc/php-manual-en/class.yaf-exception-typeerror.html
    • /usr/share/doc/php-manual-en/class.yaf-exception.html
    • /usr/share/doc/php-manual-en/class.yaf-loader.html
    • /usr/share/doc/php-manual-en/class.yaf-plugin-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-registry.html
    • /usr/share/doc/php-manual-en/class.yaf-request-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-request-http.html
    • /usr/share/doc/php-manual-en/class.yaf-request-simple.html
    • /usr/share/doc/php-manual-en/class.yaf-response-abstract.html
    • /usr/share/doc/php-manual-en/class.yaf-route-interface.html
    • /usr/share/doc/php-manual-en/class.yaf-route-map.html
    • /usr/share/doc/php-manual-en/class.yaf-route-regex.html
    • /usr/share/doc/php-manual-en/class.yaf-route-rewrite.html
    • /usr/share/doc/php-manual-en/class.yaf-route-simple.html
    • /usr/share/doc/php-manual-en/class.yaf-route-static.html
    • /usr/share/doc/php-manual-en/class.yaf-route-supervar.html
    • /usr/share/doc/php-manual-en/class.yaf-router.html
    • /usr/share/doc/php-manual-en/class.yaf-session.html
    • /usr/share/doc/php-manual-en/class.yaf-view-interface.html
    • /usr/share/doc/php-manual-en/class.yaf-view-simple.html
    • /usr/share/doc/php-manual-en/class.yar-client-exception.html
    • /usr/share/doc/php-manual-en/class.yar-client.html
    • /usr/share/doc/php-manual-en/class.yar-concurrent-client.html
    • /usr/share/doc/php-manual-en/class.yar-server-exception.html
    • /usr/share/doc/php-manual-en/class.yar-server.html
    • /usr/share/doc/php-manual-en/class.ziparchive.html
    • /usr/share/doc/php-manual-en/class.zmq.html
    • /usr/share/doc/php-manual-en/class.zmqcontext.html
    • /usr/share/doc/php-manual-en/class.zmqdevice.html
    • /usr/share/doc/php-manual-en/class.zmqpoll.html
    • /usr/share/doc/php-manual-en/class.zmqsocket.html
    • /usr/share/doc/php-manual-en/classkit.configuration.html
    • /usr/share/doc/php-manual-en/classkit.constants.html
    • /usr/share/doc/php-manual-en/classkit.installation.html
    • /usr/share/doc/php-manual-en/classkit.requirements.html
    • /usr/share/doc/php-manual-en/classkit.resources.html
    • /usr/share/doc/php-manual-en/classkit.setup.html
    • /usr/share/doc/php-manual-en/classobj.configuration.html
    • /usr/share/doc/php-manual-en/classobj.constants.html
    • /usr/share/doc/php-manual-en/classobj.examples.html
    • /usr/share/doc/php-manual-en/classobj.installation.html
    • /usr/share/doc/php-manual-en/classobj.requirements.html
    • /usr/share/doc/php-manual-en/classobj.resources.html
    • /usr/share/doc/php-manual-en/classobj.setup.html
    • /usr/share/doc/php-manual-en/closure.bind.html
    • /usr/share/doc/php-manual-en/closure.bindto.html
    • /usr/share/doc/php-manual-en/closure.construct.html
    • /usr/share/doc/php-manual-en/collator.asort.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/collator.construct.html
    • /usr/share/doc/php-manual-en/collator.create.html
    • /usr/share/doc/php-manual-en/collator.getattribute.html
    • /usr/share/doc/php-manual-en/collator.geterrorcode.html
    • /usr/share/doc/php-manual-en/collator.geterrormessage.html
    • /usr/share/doc/php-manual-en/collator.getlocale.html
    • /usr/share/doc/php-manual-en/collator.getsortkey.html
    • /usr/share/doc/php-manual-en/collator.getstrength.html
    • /usr/share/doc/php-manual-en/collator.setattribute.html
    • /usr/share/doc/php-manual-en/collator.setstrength.html
    • /usr/share/doc/php-manual-en/collator.sort.html
    • /usr/share/doc/php-manual-en/collator.sortwithsortkeys.html
    • /usr/share/doc/php-manual-en/com.configuration.html
    • /usr/share/doc/php-manual-en/com.constants.html
    • /usr/share/doc/php-manual-en/com.error-handling.html
    • /usr/share/doc/php-manual-en/com.examples.arrays.html
    • /usr/share/doc/php-manual-en/com.examples.foreach.html
    • /usr/share/doc/php-manual-en/com.examples.html
    • /usr/share/doc/php-manual-en/com.installation.html
    • /usr/share/doc/php-manual-en/com.requirements.html
    • /usr/share/doc/php-manual-en/com.resources.html
    • /usr/share/doc/php-manual-en/com.setup.html
    • /usr/share/doc/php-manual-en/cond.broadcast.html
    • /usr/share/doc/php-manual-en/cond.create.html
    • /usr/share/doc/php-manual-en/cond.destroy.html
    • /usr/share/doc/php-manual-en/cond.signal.html
    • /usr/share/doc/php-manual-en/cond.wait.html
    • /usr/share/doc/php-manual-en/configuration.changes.html
    • /usr/share/doc/php-manual-en/configuration.changes.modes.html
    • /usr/share/doc/php-manual-en/configuration.file.html
    • /usr/share/doc/php-manual-en/configuration.file.per-user.html
    • /usr/share/doc/php-manual-en/configuration.html
    • /usr/share/doc/php-manual-en/configure.about.html
    • /usr/share/doc/php-manual-en/configure.html
    • /usr/share/doc/php-manual-en/constants.dbx.html
    • /usr/share/doc/php-manual-en/constants.newt.anchor.html
    • /usr/share/doc/php-manual-en/constants.newt.args-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.cbtree-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.colorsets.html
    • /usr/share/doc/php-manual-en/constants.newt.components-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.entry-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.fd-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.form-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.grid-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.keys.html
    • /usr/share/doc/php-manual-en/constants.newt.listbox-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.reasons.html
    • /usr/share/doc/php-manual-en/constants.newt.sense-flags.html
    • /usr/share/doc/php-manual-en/constants.newt.textbox-flags.html
    • /usr/share/doc/php-manual-en/context.curl.html
    • /usr/share/doc/php-manual-en/context.ftp.html
    • /usr/share/doc/php-manual-en/context.html
    • /usr/share/doc/php-manual-en/context.http.html
    • /usr/share/doc/php-manual-en/context.params.html
    • /usr/share/doc/php-manual-en/context.phar.html
    • /usr/share/doc/php-manual-en/context.socket.html
    • /usr/share/doc/php-manual-en/context.ssl.html
    • /usr/share/doc/php-manual-en/control-structures.alternative-syntax.html
    • /usr/share/doc/php-manual-en/control-structures.break.html
    • /usr/share/doc/php-manual-en/control-structures.continue.html
    • /usr/share/doc/php-manual-en/control-structures.declare.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/control-structures.else.html
    • /usr/share/doc/php-manual-en/control-structures.elseif.html
    • /usr/share/doc/php-manual-en/control-structures.for.html
    • /usr/share/doc/php-manual-en/control-structures.foreach.html
    • /usr/share/doc/php-manual-en/control-structures.goto.html
    • /usr/share/doc/php-manual-en/control-structures.if.html
    • /usr/share/doc/php-manual-en/control-structures.intro.html
    • /usr/share/doc/php-manual-en/control-structures.switch.html
    • /usr/share/doc/php-manual-en/control-structures.while.html
    • /usr/share/doc/php-manual-en/copyright.html
    • /usr/share/doc/php-manual-en/countable.count.html
    • /usr/share/doc/php-manual-en/crack.configuration.html
    • /usr/share/doc/php-manual-en/crack.constants.html
    • /usr/share/doc/php-manual-en/crack.examples.html
    • /usr/share/doc/php-manual-en/crack.installation.html
    • /usr/share/doc/php-manual-en/crack.requirements.html
    • /usr/share/doc/php-manual-en/crack.resources.html
    • /usr/share/doc/php-manual-en/crack.setup.html
    • /usr/share/doc/php-manual-en/ctype.configuration.html
    • /usr/share/doc/php-manual-en/ctype.constants.html
    • /usr/share/doc/php-manual-en/ctype.installation.html
    • /usr/share/doc/php-manual-en/ctype.requirements.html
    • /usr/share/doc/php-manual-en/ctype.resources.html
    • /usr/share/doc/php-manual-en/ctype.setup.html
    • /usr/share/doc/php-manual-en/cubrid.configuration.html
    • /usr/share/doc/php-manual-en/cubrid.constants.html
    • /usr/share/doc/php-manual-en/cubrid.examples.html
    • /usr/share/doc/php-manual-en/cubrid.installation.html
    • /usr/share/doc/php-manual-en/cubrid.requirements.html
    • /usr/share/doc/php-manual-en/cubrid.resources.html
    • /usr/share/doc/php-manual-en/cubrid.setup.html
    • /usr/share/doc/php-manual-en/cubridmysql.cubrid.html
    • /usr/share/doc/php-manual-en/curl.configuration.html
    • /usr/share/doc/php-manual-en/curl.constants.html
    • /usr/share/doc/php-manual-en/curl.examples-basic.html
    • /usr/share/doc/php-manual-en/curl.examples.html
    • /usr/share/doc/php-manual-en/curl.installation.html
    • /usr/share/doc/php-manual-en/curl.requirements.html
    • /usr/share/doc/php-manual-en/curl.resources.html
    • /usr/share/doc/php-manual-en/curl.setup.html
    • /usr/share/doc/php-manual-en/curlfile.construct.html
    • /usr/share/doc/php-manual-en/curlfile.getfilename.html
    • /usr/share/doc/php-manual-en/curlfile.getmimetype.html
    • /usr/share/doc/php-manual-en/curlfile.getpostfilename.html
    • /usr/share/doc/php-manual-en/curlfile.setmimetype.html
    • /usr/share/doc/php-manual-en/curlfile.setpostfilename.html
    • /usr/share/doc/php-manual-en/curlfile.wakeup.html
    • /usr/share/doc/php-manual-en/cyrus.configuration.html
    • /usr/share/doc/php-manual-en/cyrus.constants.html
    • /usr/share/doc/php-manual-en/cyrus.installation.html
    • /usr/share/doc/php-manual-en/cyrus.requirements.html
    • /usr/share/doc/php-manual-en/cyrus.resources.html
    • /usr/share/doc/php-manual-en/cyrus.setup.html
    • /usr/share/doc/php-manual-en/dateinterval.construct.html
    • /usr/share/doc/php-manual-en/dateinterval.createfromdatestring.html
    • /usr/share/doc/php-manual-en/dateinterval.format.html
    • /usr/share/doc/php-manual-en/dateperiod.construct.html
    • /usr/share/doc/php-manual-en/datetime.add.html
    • /usr/share/doc/php-manual-en/datetime.configuration.html
    • /usr/share/doc/php-manual-en/datetime.constants.html
    • /usr/share/doc/php-manual-en/datetime.construct.html
    • /usr/share/doc/php-manual-en/datetime.createfromformat.html
    • /usr/share/doc/php-manual-en/datetime.diff.html
    • /usr/share/doc/php-manual-en/datetime.format.html
    • /usr/share/doc/php-manual-en/datetime.formats.compound.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/datetime.formats.html
    • /usr/share/doc/php-manual-en/datetime.formats.relative.html
    • /usr/share/doc/php-manual-en/datetime.formats.time.html
    • /usr/share/doc/php-manual-en/datetime.getlasterrors.html
    • /usr/share/doc/php-manual-en/datetime.getoffset.html
    • /usr/share/doc/php-manual-en/datetime.gettimestamp.html
    • /usr/share/doc/php-manual-en/datetime.gettimezone.html
    • /usr/share/doc/php-manual-en/datetime.installation.html
    • /usr/share/doc/php-manual-en/datetime.modify.html
    • /usr/share/doc/php-manual-en/datetime.requirements.html
    • /usr/share/doc/php-manual-en/datetime.resources.html
    • /usr/share/doc/php-manual-en/datetime.set-state.html
    • /usr/share/doc/php-manual-en/datetime.setdate.html
    • /usr/share/doc/php-manual-en/datetime.setisodate.html
    • /usr/share/doc/php-manual-en/datetime.settime.html
    • /usr/share/doc/php-manual-en/datetime.settimestamp.html
    • /usr/share/doc/php-manual-en/datetime.settimezone.html
    • /usr/share/doc/php-manual-en/datetime.setup.html
    • /usr/share/doc/php-manual-en/datetime.sub.html
    • /usr/share/doc/php-manual-en/datetime.wakeup.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.add.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.construct.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.createfromformat.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.getlasterrors.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.modify.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.set-state.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.setdate.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.setisodate.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.settime.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.settimestamp.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.settimezone.html
    • /usr/share/doc/php-manual-en/datetimeimmutable.sub.html
    • /usr/share/doc/php-manual-en/datetimezone.construct.html
    • /usr/share/doc/php-manual-en/datetimezone.getlocation.html
    • /usr/share/doc/php-manual-en/datetimezone.getname.html
    • /usr/share/doc/php-manual-en/datetimezone.getoffset.html
    • /usr/share/doc/php-manual-en/datetimezone.gettransitions.html
    • /usr/share/doc/php-manual-en/datetimezone.listabbreviations.html
    • /usr/share/doc/php-manual-en/datetimezone.listidentifiers.html
    • /usr/share/doc/php-manual-en/dba.configuration.html
    • /usr/share/doc/php-manual-en/dba.constants.html
    • /usr/share/doc/php-manual-en/dba.example.html
    • /usr/share/doc/php-manual-en/dba.examples.html
    • /usr/share/doc/php-manual-en/dba.installation.html
    • /usr/share/doc/php-manual-en/dba.requirements.html
    • /usr/share/doc/php-manual-en/dba.resources.html
    • /usr/share/doc/php-manual-en/dba.setup.html
    • /usr/share/doc/php-manual-en/dbase.configuration.html
    • /usr/share/doc/php-manual-en/dbase.constants.html
    • /usr/share/doc/php-manual-en/dbase.installation.html
    • /usr/share/doc/php-manual-en/dbase.requirements.html
    • /usr/share/doc/php-manual-en/dbase.resources.html
    • /usr/share/doc/php-manual-en/dbase.setup.html
    • /usr/share/doc/php-manual-en/dbplus.configuration.html
    • /usr/share/doc/php-manual-en/dbplus.constants.html
    • /usr/share/doc/php-manual-en/dbplus.errorcodes.html
    • /usr/share/doc/php-manual-en/dbplus.installation.html
    • /usr/share/doc/php-manual-en/dbplus.requirements.html
    • /usr/share/doc/php-manual-en/dbplus.resources.html
    • /usr/share/doc/php-manual-en/dbplus.setup.html
    • /usr/share/doc/php-manual-en/dbx.configuration.html
    • /usr/share/doc/php-manual-en/dbx.installation.html
    • /usr/share/doc/php-manual-en/dbx.requirements.html
    • /usr/share/doc/php-manual-en/dbx.resources.html
    • /usr/share/doc/php-manual-en/dbx.setup.html
    • /usr/share/doc/php-manual-en/debugger-about.html
    • /usr/share/doc/php-manual-en/debugger.html
    • /usr/share/doc/php-manual-en/dio.configuration.html
    • /usr/share/doc/php-manual-en/dio.constants.html
    • /usr/share/doc/php-manual-en/dio.installation.html
    • /usr/share/doc/php-manual-en/dio.requirements.html
    • /usr/share/doc/php-manual-en/dio.resources.html
    • /usr/share/doc/php-manual-en/dio.setup.html
    • /usr/share/doc/php-manual-en/dir.configuration.html
    • /usr/share/doc/php-manual-en/dir.constants.html
    • /usr/share/doc/php-manual-en/dir.installation.html
    • /usr/share/doc/php-manual-en/dir.requirements.html
    • /usr/share/doc/php-manual-en/dir.resources.html
    • /usr/share/doc/php-manual-en/dir.setup.html
    • /usr/share/doc/php-manual-en/directory.close.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/directory.rewind.html
    • /usr/share/doc/php-manual-en/directoryiterator.construct.html
    • /usr/share/doc/php-manual-en/directoryiterator.current.html
    • /usr/share/doc/php-manual-en/directoryiterator.getatime.html
    • /usr/share/doc/php-manual-en/directoryiterator.getbasename.html
    • /usr/share/doc/php-manual-en/directoryiterator.getctime.html
    • /usr/share/doc/php-manual-en/directoryiterator.getextension.html
    • /usr/share/doc/php-manual-en/directoryiterator.getfilename.html
    • /usr/share/doc/php-manual-en/directoryiterator.getgroup.html
    • /usr/share/doc/php-manual-en/directoryiterator.getinode.html
    • /usr/share/doc/php-manual-en/directoryiterator.getmtime.html
    • /usr/share/doc/php-manual-en/directoryiterator.getowner.html
    • /usr/share/doc/php-manual-en/directoryiterator.getpath.html
    • /usr/share/doc/php-manual-en/directoryiterator.getpathname.html
    • /usr/share/doc/php-manual-en/directoryiterator.getperms.html
    • /usr/share/doc/php-manual-en/directoryiterator.getsize.html
    • /usr/share/doc/php-manual-en/directoryiterator.gettype.html
    • /usr/share/doc/php-manual-en/directoryiterator.isdir.html
    • /usr/share/doc/php-manual-en/directoryiterator.isdot.html
    • /usr/share/doc/php-manual-en/directoryiterator.isexecutable.html
    • /usr/share/doc/php-manual-en/directoryiterator.isfile.html
    • /usr/share/doc/php-manual-en/directoryiterator.islink.html
    • /usr/share/doc/php-manual-en/directoryiterator.isreadable.html
    • /usr/share/doc/php-manual-en/directoryiterator.iswritable.html
    • /usr/share/doc/php-manual-en/directoryiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/directoryiterator.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/directoryiterator.tostring.html
    • /usr/share/doc/php-manual-en/directoryiterator.valid.html
    • /usr/share/doc/php-manual-en/doc.changelog.html
    • /usr/share/doc/php-manual-en/dom.configuration.html
    • /usr/share/doc/php-manual-en/dom.constants.html
    • /usr/share/doc/php-manual-en/dom.examples.html
    • /usr/share/doc/php-manual-en/dom.installation.html
    • /usr/share/doc/php-manual-en/dom.requirements.html
    • /usr/share/doc/php-manual-en/dom.resources.html
    • /usr/share/doc/php-manual-en/dom.setup.html
    • /usr/share/doc/php-manual-en/domattr.construct.html
    • /usr/share/doc/php-manual-en/domattr.isid.html
    • /usr/share/doc/php-manual-en/domcdatasection.construct.html
    • /usr/share/doc/php-manual-en/domcharacterdata.appenddata.html
    • /usr/share/doc/php-manual-en/domcharacterdata.deletedata.html
    • /usr/share/doc/php-manual-en/domcharacterdata.insertdata.html
    • /usr/share/doc/php-manual-en/domcharacterdata.replacedata.html
    • /usr/share/doc/php-manual-en/domcharacterdata.substringdata.html
    • /usr/share/doc/php-manual-en/domcomment.construct.html
    • /usr/share/doc/php-manual-en/domdocument.construct.html
    • /usr/share/doc/php-manual-en/domdocument.createattribute.html
    • /usr/share/doc/php-manual-en/domdocument.createattributens.html
    • /usr/share/doc/php-manual-en/domdocument.createcdatasection.html
    • /usr/share/doc/php-manual-en/domdocument.createcomment.html
    • /usr/share/doc/php-manual-en/domdocument.createdocumentfragment.html
    • /usr/share/doc/php-manual-en/domdocument.createelement.html
    • /usr/share/doc/php-manual-en/domdocument.createelementns.html
    • /usr/share/doc/php-manual-en/domdocument.createentityreference.html
    • /usr/share/doc/php-manual-en/domdocument.createprocessinginstruction.html
    • /usr/share/doc/php-manual-en/domdocument.createtextnode.html
    • /usr/share/doc/php-manual-en/domdocument.getelementbyid.html
    • /usr/share/doc/php-manual-en/domdocument.getelementsbytagname.html
    • /usr/share/doc/php-manual-en/domdocument.getelementsbytagnamens.html
    • /usr/share/doc/php-manual-en/domdocument.importnode.html
    • /usr/share/doc/php-manual-en/domdocument.load.html
    • /usr/share/doc/php-manual-en/domdocument.loadhtml.html
    • /usr/share/doc/php-manual-en/domdocument.loadhtmlfile.html
    • /usr/share/doc/php-manual-en/domdocument.loadxml.html
    • /usr/share/doc/php-manual-en/domdocument.normalizedocument.html
    • /usr/share/doc/php-manual-en/domdocument.registernodeclass.html
    • /usr/share/doc/php-manual-en/domdocument.relaxngvalidate.html
    • /usr/share/doc/php-manual-en/domdocument.relaxngvalidatesource.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/domdocument.savehtml.html
    • /usr/share/doc/php-manual-en/domdocument.savehtmlfile.html
    • /usr/share/doc/php-manual-en/domdocument.savexml.html
    • /usr/share/doc/php-manual-en/domdocument.schemavalidate.html
    • /usr/share/doc/php-manual-en/domdocument.schemavalidatesource.html
    • /usr/share/doc/php-manual-en/domdocument.validate.html
    • /usr/share/doc/php-manual-en/domdocument.xinclude.html
    • /usr/share/doc/php-manual-en/domdocumentfragment.appendxml.html
    • /usr/share/doc/php-manual-en/domelement.construct.html
    • /usr/share/doc/php-manual-en/domelement.getattribute.html
    • /usr/share/doc/php-manual-en/domelement.getattributenode.html
    • /usr/share/doc/php-manual-en/domelement.getattributenodens.html
    • /usr/share/doc/php-manual-en/domelement.getattributens.html
    • /usr/share/doc/php-manual-en/domelement.getelementsbytagname.html
    • /usr/share/doc/php-manual-en/domelement.getelementsbytagnamens.html
    • /usr/share/doc/php-manual-en/domelement.hasattribute.html
    • /usr/share/doc/php-manual-en/domelement.hasattributens.html
    • /usr/share/doc/php-manual-en/domelement.removeattribute.html
    • /usr/share/doc/php-manual-en/domelement.removeattributenode.html
    • /usr/share/doc/php-manual-en/domelement.removeattributens.html
    • /usr/share/doc/php-manual-en/domelement.setattribute.html
    • /usr/share/doc/php-manual-en/domelement.setattributenode.html
    • /usr/share/doc/php-manual-en/domelement.setattributenodens.html
    • /usr/share/doc/php-manual-en/domelement.setattributens.html
    • /usr/share/doc/php-manual-en/domelement.setidattribute.html
    • /usr/share/doc/php-manual-en/domelement.setidattributenode.html
    • /usr/share/doc/php-manual-en/domelement.setidattributens.html
    • /usr/share/doc/php-manual-en/domentityreference.construct.html
    • /usr/share/doc/php-manual-en/domimplementation.construct.html
    • /usr/share/doc/php-manual-en/domimplementation.createdocument.html
    • /usr/share/doc/php-manual-en/domimplementation.createdocumenttype.html
    • /usr/share/doc/php-manual-en/domimplementation.hasfeature.html
    • /usr/share/doc/php-manual-en/domnamednodemap.getnameditem.html
    • /usr/share/doc/php-manual-en/domnamednodemap.getnameditemns.html
    • /usr/share/doc/php-manual-en/domnamednodemap.item.html
    • /usr/share/doc/php-manual-en/domnode.appendchild.html
    • /usr/share/doc/php-manual-en/domnode.c14n.html
    • /usr/share/doc/php-manual-en/domnode.c14nfile.html
    • /usr/share/doc/php-manual-en/domnode.clonenode.html
    • /usr/share/doc/php-manual-en/domnode.getlineno.html
    • /usr/share/doc/php-manual-en/domnode.getnodepath.html
    • /usr/share/doc/php-manual-en/domnode.hasattributes.html
    • /usr/share/doc/php-manual-en/domnode.haschildnodes.html
    • /usr/share/doc/php-manual-en/domnode.insertbefore.html
    • /usr/share/doc/php-manual-en/domnode.isdefaultnamespace.html
    • /usr/share/doc/php-manual-en/domnode.issamenode.html
    • /usr/share/doc/php-manual-en/domnode.issupported.html
    • /usr/share/doc/php-manual-en/domnode.lookupnamespaceuri.html
    • /usr/share/doc/php-manual-en/domnode.lookupprefix.html
    • /usr/share/doc/php-manual-en/domnode.normalize.html
    • /usr/share/doc/php-manual-en/domnode.removechild.html
    • /usr/share/doc/php-manual-en/domnode.replacechild.html
    • /usr/share/doc/php-manual-en/domnodelist.item.html
    • /usr/share/doc/php-manual-en/domprocessinginstruction.construct.html
    • /usr/share/doc/php-manual-en/domtext.construct.html
    • /usr/share/doc/php-manual-en/domtext.iswhitespaceinelementcontent.html
    • /usr/share/doc/php-manual-en/domtext.splittext.html
    • /usr/share/doc/php-manual-en/domxpath.construct.html
    • /usr/share/doc/php-manual-en/domxpath.evaluate.html
    • /usr/share/doc/php-manual-en/domxpath.query.html
    • /usr/share/doc/php-manual-en/domxpath.registernamespace.html
    • /usr/share/doc/php-manual-en/domxpath.registerphpfunctions.html
    • /usr/share/doc/php-manual-en/dotnet.configuration.html
    • /usr/share/doc/php-manual-en/dotnet.constants.html
    • /usr/share/doc/php-manual-en/dotnet.installation.html
    • /usr/share/doc/php-manual-en/dotnet.intro.html
    • /usr/share/doc/php-manual-en/dotnet.requirements.html
    • /usr/share/doc/php-manual-en/dotnet.resources.html
    • /usr/share/doc/php-manual-en/dotnet.setup.html
    • /usr/share/doc/php-manual-en/eio.configuration.html
    • /usr/share/doc/php-manual-en/eio.constants.html
    • /usr/share/doc/php-manual-en/eio.examples.html
    • /usr/share/doc/php-manual-en/eio.installation.html
    • /usr/share/doc/php-manual-en/eio.requirements.html
    • /usr/share/doc/php-manual-en/eio.resources.html
    • /usr/share/doc/php-manual-en/eio.setup.html
    • /usr/share/doc/php-manual-en/emptyiterator.current.html
    • /usr/share/doc/php-manual-en/emptyiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/emptyiterator.rewind.html
    • /usr/share/doc/php-manual-en/emptyiterator.valid.html
    • /usr/share/doc/php-manual-en/enchant.configuration.html
    • /usr/share/doc/php-manual-en/enchant.constants.html
    • /usr/share/doc/php-manual-en/enchant.examples.html
    • /usr/share/doc/php-manual-en/enchant.installation.html
    • /usr/share/doc/php-manual-en/enchant.requirements.html
    • /usr/share/doc/php-manual-en/enchant.resources.html
    • /usr/share/doc/php-manual-en/enchant.setup.html
    • /usr/share/doc/php-manual-en/errorexception.construct.html
    • /usr/share/doc/php-manual-en/errorexception.getseverity.html
    • /usr/share/doc/php-manual-en/errorfunc.configuration.html
    • /usr/share/doc/php-manual-en/errorfunc.constants.html
    • /usr/share/doc/php-manual-en/errorfunc.examples.html
    • /usr/share/doc/php-manual-en/errorfunc.installation.html
    • /usr/share/doc/php-manual-en/errorfunc.requirements.html
    • /usr/share/doc/php-manual-en/errorfunc.resources.html
    • /usr/share/doc/php-manual-en/errorfunc.setup.html
    • /usr/share/doc/php-manual-en/ev.backend.html
    • /usr/share/doc/php-manual-en/ev.configuration.html
    • /usr/share/doc/php-manual-en/ev.depth.html
    • /usr/share/doc/php-manual-en/ev.embeddablebackends.html
    • /usr/share/doc/php-manual-en/ev.examples.html
    • /usr/share/doc/php-manual-en/ev.feedsignal.html
    • /usr/share/doc/php-manual-en/ev.feedsignalevent.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ev.installation.html
    • /usr/share/doc/php-manual-en/ev.iteration.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ev.nowupdate.html
    • /usr/share/doc/php-manual-en/ev.periodic-modes.html
    • /usr/share/doc/php-manual-en/ev.recommendedbackends.html
    • /usr/share/doc/php-manual-en/ev.requirements.html
    • /usr/share/doc/php-manual-en/ev.resources.html
    • /usr/share/doc/php-manual-en/ev.resume.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ev.setup.html
    • /usr/share/doc/php-manual-en/ev.sleep.html
    • /usr/share/doc/php-manual-en/ev.stop.html
    • /usr/share/doc/php-manual-en/ev.supportedbackends.html
    • /usr/share/doc/php-manual-en/ev.suspend.html
    • /usr/share/doc/php-manual-en/ev.time.html
    • /usr/share/doc/php-manual-en/ev.verify.html
    • /usr/share/doc/php-manual-en/ev.watcher-callbacks.html
    • /usr/share/doc/php-manual-en/ev.watchers.html
    • /usr/share/doc/php-manual-en/evcheck.construct.html
    • /usr/share/doc/php-manual-en/evcheck.createstopped.html
    • /usr/share/doc/php-manual-en/evchild.construct.html
    • /usr/share/doc/php-manual-en/evchild.createstopped.html
    • /usr/share/doc/php-manual-en/evchild.set.html
    • /usr/share/doc/php-manual-en/evembed.construct.html
    • /usr/share/doc/php-manual-en/evembed.createstopped.html
    • /usr/share/doc/php-manual-en/evembed.set.html
    • /usr/share/doc/php-manual-en/evembed.sweep.html
    • /usr/share/doc/php-manual-en/event.add.html
    • /usr/share/doc/php-manual-en/event.addsignal.html
    • /usr/share/doc/php-manual-en/event.addtimer.html
    • /usr/share/doc/php-manual-en/event.callbacks.html
    • /usr/share/doc/php-manual-en/event.configuration.html
    • /usr/share/doc/php-manual-en/event.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/event.del.html
    • /usr/share/doc/php-manual-en/event.delsignal.html
    • /usr/share/doc/php-manual-en/event.deltimer.html
    • /usr/share/doc/php-manual-en/event.examples.html
    • /usr/share/doc/php-manual-en/event.flags.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/event.getsupportedmethods.html
    • /usr/share/doc/php-manual-en/event.installation.html
    • /usr/share/doc/php-manual-en/event.pending.html
    • /usr/share/doc/php-manual-en/event.persistence.html
    • /usr/share/doc/php-manual-en/event.requirements.html
    • /usr/share/doc/php-manual-en/event.resources.html
    • /usr/share/doc/php-manual-en/event.set.html
    • /usr/share/doc/php-manual-en/event.setpriority.html
    • /usr/share/doc/php-manual-en/event.settimer.html
    • /usr/share/doc/php-manual-en/event.setup.html
    • /usr/share/doc/php-manual-en/event.signal.html
    • /usr/share/doc/php-manual-en/event.timer.html
    • /usr/share/doc/php-manual-en/eventbase.construct.html
    • /usr/share/doc/php-manual-en/eventbase.dispatch.html
    • /usr/share/doc/php-manual-en/eventbase.exit.html
    • /usr/share/doc/php-manual-en/eventbase.getfeatures.html
    • /usr/share/doc/php-manual-en/eventbase.getmethod.html
    • /usr/share/doc/php-manual-en/eventbase.gettimeofdaycached.html
    • /usr/share/doc/php-manual-en/eventbase.gotexit.html
    • /usr/share/doc/php-manual-en/eventbase.gotstop.html
    • /usr/share/doc/php-manual-en/eventbase.loop.html
    • /usr/share/doc/php-manual-en/eventbase.priorityinit.html
    • /usr/share/doc/php-manual-en/eventbase.reinit.html
    • /usr/share/doc/php-manual-en/eventbase.stop.html
    • /usr/share/doc/php-manual-en/eventbuffer.add.html
    • /usr/share/doc/php-manual-en/eventbuffer.addbuffer.html
    • /usr/share/doc/php-manual-en/eventbuffer.appendfrom.html
    • /usr/share/doc/php-manual-en/eventbuffer.construct.html
    • /usr/share/doc/php-manual-en/eventbuffer.copyout.html
    • /usr/share/doc/php-manual-en/eventbuffer.drain.html
    • /usr/share/doc/php-manual-en/eventbuffer.enablelocking.html
    • /usr/share/doc/php-manual-en/eventbuffer.expand.html
    • /usr/share/doc/php-manual-en/eventbuffer.freeze.html
    • /usr/share/doc/php-manual-en/eventbuffer.lock.html
    • /usr/share/doc/php-manual-en/eventbuffer.prepend.html
    • /usr/share/doc/php-manual-en/eventbuffer.prependbuffer.html
    • /usr/share/doc/php-manual-en/eventbuffer.pullup.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/eventbuffer.readfrom.html
    • /usr/share/doc/php-manual-en/eventbuffer.readline.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/eventbuffer.searcheol.html
    • /usr/share/doc/php-manual-en/eventbuffer.substr.html
    • /usr/share/doc/php-manual-en/eventbuffer.unfreeze.html
    • /usr/share/doc/php-manual-en/eventbuffer.unlock.html
    • /usr/share/doc/php-manual-en/eventbuffer.write.html
    • /usr/share/doc/php-manual-en/eventbufferevent.about.callbacks.html
    • /usr/share/doc/php-manual-en/eventbufferevent.connect.html
    • /usr/share/doc/php-manual-en/eventbufferevent.connecthost.html
    • /usr/share/doc/php-manual-en/eventbufferevent.construct.html
    • /usr/share/doc/php-manual-en/eventbufferevent.createpair.html
    • /usr/share/doc/php-manual-en/eventbufferevent.disable.html
    • /usr/share/doc/php-manual-en/eventbufferevent.enable.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/eventbufferevent.getdnserrorstring.html
    • /usr/share/doc/php-manual-en/eventbufferevent.getenabled.html
    • /usr/share/doc/php-manual-en/eventbufferevent.getinput.html
    • /usr/share/doc/php-manual-en/eventbufferevent.getoutput.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/eventbufferevent.readbuffer.html
    • /usr/share/doc/php-manual-en/eventbufferevent.setcallbacks.html
    • /usr/share/doc/php-manual-en/eventbufferevent.setpriority.html
    • /usr/share/doc/php-manual-en/eventbufferevent.settimeouts.html
    • /usr/share/doc/php-manual-en/eventbufferevent.setwatermark.html
    • /usr/share/doc/php-manual-en/eventbufferevent.sslerror.html
    • /usr/share/doc/php-manual-en/eventbufferevent.sslfilter.html
    • /usr/share/doc/php-manual-en/eventbufferevent.sslrenegotiate.html
    • /usr/share/doc/php-manual-en/eventbufferevent.sslsocket.html
    • /usr/share/doc/php-manual-en/eventbufferevent.write.html
    • /usr/share/doc/php-manual-en/eventbufferevent.writebuffer.html
    • /usr/share/doc/php-manual-en/eventconfig.avoidmethod.html
    • /usr/share/doc/php-manual-en/eventconfig.construct.html
    • /usr/share/doc/php-manual-en/eventconfig.requirefeatures.html
    • /usr/share/doc/php-manual-en/eventconfig.setmaxdispatchinterval.html
    • /usr/share/doc/php-manual-en/eventdnsbase.addnameserverip.html
    • /usr/share/doc/php-manual-en/eventdnsbase.addsearch.html
    • /usr/share/doc/php-manual-en/eventdnsbase.clearsearch.html
    • /usr/share/doc/php-manual-en/eventdnsbase.construct.html
    • /usr/share/doc/php-manual-en/eventdnsbase.countnameservers.html
    • /usr/share/doc/php-manual-en/eventdnsbase.loadhosts.html
    • /usr/share/doc/php-manual-en/eventdnsbase.parseresolvconf.html
    • /usr/share/doc/php-manual-en/eventdnsbase.setoption.html
    • /usr/share/doc/php-manual-en/eventdnsbase.setsearchndots.html
    • /usr/share/doc/php-manual-en/eventhttp.accept.html
    • /usr/share/doc/php-manual-en/eventhttp.addserveralias.html
    • /usr/share/doc/php-manual-en/eventhttp.bind.html
    • /usr/share/doc/php-manual-en/eventhttp.construct.html
    • /usr/share/doc/php-manual-en/eventhttp.removeserveralias.html
    • /usr/share/doc/php-manual-en/eventhttp.setallowedmethods.html
    • /usr/share/doc/php-manual-en/eventhttp.setcallback.html
    • /usr/share/doc/php-manual-en/eventhttp.setdefaultcallback.html
    • /usr/share/doc/php-manual-en/eventhttp.setmaxbodysize.html
    • /usr/share/doc/php-manual-en/eventhttp.setmaxheaderssize.html
    • /usr/share/doc/php-manual-en/eventhttp.settimeout.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.construct.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.getbase.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.getpeer.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.makerequest.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setclosecallback.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setlocaladdress.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setlocalport.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setmaxbodysize.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setmaxheaderssize.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.setretries.html
    • /usr/share/doc/php-manual-en/eventhttpconnection.settimeout.html
    • /usr/share/doc/php-manual-en/eventhttprequest.addheader.html
    • /usr/share/doc/php-manual-en/eventhttprequest.cancel.html
    • /usr/share/doc/php-manual-en/eventhttprequest.clearheaders.html
    • /usr/share/doc/php-manual-en/eventhttprequest.closeconnection.html
    • /usr/share/doc/php-manual-en/eventhttprequest.construct.html
    • /usr/share/doc/php-manual-en/eventhttprequest.findheader.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/eventhttprequest.getbufferevent.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getcommand.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getconnection.html
    • /usr/share/doc/php-manual-en/eventhttprequest.gethost.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getinputbuffer.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getinputheaders.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getoutputbuffer.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getoutputheaders.html
    • /usr/share/doc/php-manual-en/eventhttprequest.getresponsecode.html
    • /usr/share/doc/php-manual-en/eventhttprequest.geturi.html
    • /usr/share/doc/php-manual-en/eventhttprequest.removeheader.html
    • /usr/share/doc/php-manual-en/eventhttprequest.senderror.html
    • /usr/share/doc/php-manual-en/eventhttprequest.sendreply.html
    • /usr/share/doc/php-manual-en/eventhttprequest.sendreplychunk.html
    • /usr/share/doc/php-manual-en/eventhttprequest.sendreplyend.html
    • /usr/share/doc/php-manual-en/eventhttprequest.sendreplystart.html
    • /usr/share/doc/php-manual-en/eventlistener.construct.html
    • /usr/share/doc/php-manual-en/eventlistener.disable.html
    • /usr/share/doc/php-manual-en/eventlistener.enable.html
    • /usr/share/doc/php-manual-en/eventlistener.getbase.html
    • /usr/share/doc/php-manual-en/eventlistener.getsocketname.html
    • /usr/share/doc/php-manual-en/eventlistener.setcallback.html
    • /usr/share/doc/php-manual-en/eventlistener.seterrorcallback.html
    • /usr/share/doc/php-manual-en/eventsslcontext.construct.html
    • /usr/share/doc/php-manual-en/eventutil.construct.html
    • /usr/share/doc/php-manual-en/eventutil.getlastsocketerrno.html
    • /usr/share/doc/php-manual-en/eventutil.getlastsocketerror.html
    • /usr/share/doc/php-manual-en/eventutil.getsocketfd.html
    • /usr/share/doc/php-manual-en/eventutil.getsocketname.html
    • /usr/share/doc/php-manual-en/eventutil.setsocketoption.html
    • /usr/share/doc/php-manual-en/eventutil.sslrandpoll.html
    • /usr/share/doc/php-manual-en/evfork.construct.html
    • /usr/share/doc/php-manual-en/evfork.createstopped.html
    • /usr/share/doc/php-manual-en/evidle.construct.html
    • /usr/share/doc/php-manual-en/evidle.createstopped.html
    • /usr/share/doc/php-manual-en/evio.construct.html
    • /usr/share/doc/php-manual-en/evio.createstopped.html
    • /usr/share/doc/php-manual-en/evio.set.html
    • /usr/share/doc/php-manual-en/evloop.backend.html
    • /usr/share/doc/php-manual-en/evloop.check.html
    • /usr/share/doc/php-manual-en/evloop.child.html
    • /usr/share/doc/php-manual-en/evloop.construct.html
    • /usr/share/doc/php-manual-en/evloop.defaultloop.html
    • /usr/share/doc/php-manual-en/evloop.embed.html
    • /usr/share/doc/php-manual-en/evloop.fork.html
    • /usr/share/doc/php-manual-en/evloop.idle.html
    • /usr/share/doc/php-manual-en/evloop.invokepending.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/evloop.loopfork.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/evloop.nowupdate.html
    • /usr/share/doc/php-manual-en/evloop.periodic.html
    • /usr/share/doc/php-manual-en/evloop.prepare.html
    • /usr/share/doc/php-manual-en/evloop.resume.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/evloop.signal.html
    • /usr/share/doc/php-manual-en/evloop.stat.html
    • /usr/share/doc/php-manual-en/evloop.stop.html
    • /usr/share/doc/php-manual-en/evloop.suspend.html
    • /usr/share/doc/php-manual-en/evloop.timer.html
    • /usr/share/doc/php-manual-en/evloop.verify.html
    • /usr/share/doc/php-manual-en/evperiodic.again.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/evperiodic.construct.html
    • /usr/share/doc/php-manual-en/evperiodic.createstopped.html
    • /usr/share/doc/php-manual-en/evperiodic.set.html
    • /usr/share/doc/php-manual-en/evprepare.construct.html
    • /usr/share/doc/php-manual-en/evprepare.createstopped.html
    • /usr/share/doc/php-manual-en/evsignal.construct.html
    • /usr/share/doc/php-manual-en/evsignal.createstopped.html
    • /usr/share/doc/php-manual-en/evsignal.set.html
    • /usr/share/doc/php-manual-en/evstat.attr.html
    • /usr/share/doc/php-manual-en/evstat.construct.html
    • /usr/share/doc/php-manual-en/evstat.createstopped.html
    • /usr/share/doc/php-manual-en/evstat.prev.html
    • /usr/share/doc/php-manual-en/evstat.set.html
    • /usr/share/doc/php-manual-en/evstat.stat.html
    • /usr/share/doc/php-manual-en/evtimer.again.html
    • /usr/share/doc/php-manual-en/evtimer.construct.html
    • /usr/share/doc/php-manual-en/evtimer.createstopped.html
    • /usr/share/doc/php-manual-en/evtimer.set.html
    • /usr/share/doc/php-manual-en/evwatcher.clear.html
    • /usr/share/doc/php-manual-en/evwatcher.construct.html
    • /usr/share/doc/php-manual-en/evwatcher.feed.html
    • /usr/share/doc/php-manual-en/evwatcher.getloop.html
    • /usr/share/doc/php-manual-en/evwatcher.invoke.html
    • /usr/share/doc/php-manual-en/evwatcher.keepalive.html
    • /usr/share/doc/php-manual-en/evwatcher.setcallback.html
    • /usr/share/doc/php-manual-en/evwatcher.start.html
    • /usr/share/doc/php-manual-en/evwatcher.stop.html
    • /usr/share/doc/php-manual-en/example.xml-external-entity.html
    • /usr/share/doc/php-manual-en/example.xml-map-tags.html
    • /usr/share/doc/php-manual-en/example.xml-structure.html
    • /usr/share/doc/php-manual-en/exception.clone.html
    • /usr/share/doc/php-manual-en/exception.construct.html
    • /usr/share/doc/php-manual-en/exception.getcode.html
    • /usr/share/doc/php-manual-en/exception.getfile.html
    • /usr/share/doc/php-manual-en/exception.getline.html
    • /usr/share/doc/php-manual-en/exception.getmessage.html
    • /usr/share/doc/php-manual-en/exception.getprevious.html
    • /usr/share/doc/php-manual-en/exception.gettrace.html
    • /usr/share/doc/php-manual-en/exception.gettraceasstring.html
    • /usr/share/doc/php-manual-en/exception.tostring.html
    • /usr/share/doc/php-manual-en/exec.configuration.html
    • /usr/share/doc/php-manual-en/exec.constants.html
    • /usr/share/doc/php-manual-en/exec.installation.html
    • /usr/share/doc/php-manual-en/exec.requirements.html
    • /usr/share/doc/php-manual-en/exec.resources.html
    • /usr/share/doc/php-manual-en/exec.setup.html
    • /usr/share/doc/php-manual-en/exif.configuration.html
    • /usr/share/doc/php-manual-en/exif.constants.html
    • /usr/share/doc/php-manual-en/exif.installation.html
    • /usr/share/doc/php-manual-en/exif.requirements.html
    • /usr/share/doc/php-manual-en/exif.resources.html
    • /usr/share/doc/php-manual-en/exif.setup.html
    • /usr/share/doc/php-manual-en/expect.configuration.html
    • /usr/share/doc/php-manual-en/expect.constants.html
    • /usr/share/doc/php-manual-en/expect.examples-usage.html
    • /usr/share/doc/php-manual-en/expect.examples.html
    • /usr/share/doc/php-manual-en/expect.installation.html
    • /usr/share/doc/php-manual-en/expect.requirements.html
    • /usr/share/doc/php-manual-en/expect.resources.html
    • /usr/share/doc/php-manual-en/expect.setup.html
    • /usr/share/doc/php-manual-en/extensions.alphabetical.html
    • /usr/share/doc/php-manual-en/extensions.html
    • /usr/share/doc/php-manual-en/extensions.membership.html
    • /usr/share/doc/php-manual-en/extensions.state.html
    • /usr/share/doc/php-manual-en/fam.configuration.html
    • /usr/share/doc/php-manual-en/fam.constants.html
    • /usr/share/doc/php-manual-en/fam.installation.html
    • /usr/share/doc/php-manual-en/fam.requirements.html
    • /usr/share/doc/php-manual-en/fam.resources.html
    • /usr/share/doc/php-manual-en/fam.setup.html
    • /usr/share/doc/php-manual-en/fann.configuration.html
    • /usr/share/doc/php-manual-en/fann.constants.html
    • /usr/share/doc/php-manual-en/fann.examples-1.html
    • /usr/share/doc/php-manual-en/fann.examples.html
    • /usr/share/doc/php-manual-en/fann.installation.html
    • /usr/share/doc/php-manual-en/fann.requirements.html
    • /usr/share/doc/php-manual-en/fann.resources.html
    • /usr/share/doc/php-manual-en/fann.setup.html
    • /usr/share/doc/php-manual-en/fannconnection.construct.html
    • /usr/share/doc/php-manual-en/fannconnection.getfromneuron.html
    • /usr/share/doc/php-manual-en/fannconnection.gettoneuron.html
    • /usr/share/doc/php-manual-en/fannconnection.getweight.html
    • /usr/share/doc/php-manual-en/fannconnection.setweight.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/faq.databases.html
    • /usr/share/doc/php-manual-en/faq.general.html
    • /usr/share/doc/php-manual-en/faq.html
    • /usr/share/doc/php-manual-en/faq.html.html
    • /usr/share/doc/php-manual-en/faq.installation.html
    • /usr/share/doc/php-manual-en/faq.languages.html
    • /usr/share/doc/php-manual-en/faq.mailinglist.html
    • /usr/share/doc/php-manual-en/faq.migration5.html
    • /usr/share/doc/php-manual-en/faq.misc.html
    • /usr/share/doc/php-manual-en/faq.obtaining.html
    • /usr/share/doc/php-manual-en/faq.passwords.html
    • /usr/share/doc/php-manual-en/faq.using.html
    • /usr/share/doc/php-manual-en/fbsql.configuration.html
    • /usr/share/doc/php-manual-en/fbsql.constants.html
    • /usr/share/doc/php-manual-en/fbsql.installation.html
    • /usr/share/doc/php-manual-en/fbsql.requirements.html
    • /usr/share/doc/php-manual-en/fbsql.resources.html
    • /usr/share/doc/php-manual-en/fbsql.setup.html
    • /usr/share/doc/php-manual-en/fdf.configuration.html
    • /usr/share/doc/php-manual-en/fdf.constants.html
    • /usr/share/doc/php-manual-en/fdf.examples.html
    • /usr/share/doc/php-manual-en/fdf.installation.html
    • /usr/share/doc/php-manual-en/fdf.requirements.html
    • /usr/share/doc/php-manual-en/fdf.resources.html
    • /usr/share/doc/php-manual-en/fdf.setup.html
    • /usr/share/doc/php-manual-en/features.commandline.differences.html
    • /usr/share/doc/php-manual-en/features.commandline.html
    • /usr/share/doc/php-manual-en/features.commandline.ini.html
    • /usr/share/doc/php-manual-en/features.commandline.interactive.html
    • /usr/share/doc/php-manual-en/features.commandline.introduction.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/features.commandline.options.html
    • /usr/share/doc/php-manual-en/features.commandline.usage.html
    • /usr/share/doc/php-manual-en/features.commandline.webserver.html
    • /usr/share/doc/php-manual-en/features.connection-handling.html
    • /usr/share/doc/php-manual-en/features.cookies.html
    • /usr/share/doc/php-manual-en/features.dtrace.dtrace.html
    • /usr/share/doc/php-manual-en/features.dtrace.html
    • /usr/share/doc/php-manual-en/features.dtrace.introduction.html
    • /usr/share/doc/php-manual-en/features.dtrace.systemtap.html
    • /usr/share/doc/php-manual-en/features.file-upload.common-pitfalls.html
    • /usr/share/doc/php-manual-en/features.file-upload.errors.html
    • /usr/share/doc/php-manual-en/features.file-upload.html
    • /usr/share/doc/php-manual-en/features.file-upload.multiple.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/features.file-upload.put-method.html
    • /usr/share/doc/php-manual-en/features.gc.collecting-cycles.html
    • /usr/share/doc/php-manual-en/features.gc.html
    • /usr/share/doc/php-manual-en/features.gc.performance-considerations.html
    • /usr/share/doc/php-manual-en/features.gc.refcounting-basics.html
    • /usr/share/doc/php-manual-en/features.html
    • /usr/share/doc/php-manual-en/features.http-auth.html
    • /usr/share/doc/php-manual-en/features.persistent-connections.html
    • /usr/share/doc/php-manual-en/features.remote-files.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/features.sessions.html
    • /usr/share/doc/php-manual-en/features.xforms.html
    • /usr/share/doc/php-manual-en/fileinfo.configuration.html
    • /usr/share/doc/php-manual-en/fileinfo.constants.html
    • /usr/share/doc/php-manual-en/fileinfo.installation.html
    • /usr/share/doc/php-manual-en/fileinfo.requirements.html
    • /usr/share/doc/php-manual-en/fileinfo.resources.html
    • /usr/share/doc/php-manual-en/fileinfo.setup.html
    • /usr/share/doc/php-manual-en/filepro.configuration.html
    • /usr/share/doc/php-manual-en/filepro.constants.html
    • /usr/share/doc/php-manual-en/filepro.installation.html
    • /usr/share/doc/php-manual-en/filepro.requirements.html
    • /usr/share/doc/php-manual-en/filepro.resources.html
    • /usr/share/doc/php-manual-en/filepro.setup.html
    • /usr/share/doc/php-manual-en/filesystem.configuration.html
    • /usr/share/doc/php-manual-en/filesystem.constants.html
    • /usr/share/doc/php-manual-en/filesystem.installation.html
    • /usr/share/doc/php-manual-en/filesystem.requirements.html
    • /usr/share/doc/php-manual-en/filesystem.resources.html
    • /usr/share/doc/php-manual-en/filesystem.setup.html
    • /usr/share/doc/php-manual-en/filesystemiterator.construct.html
    • /usr/share/doc/php-manual-en/filesystemiterator.current.html
    • /usr/share/doc/php-manual-en/filesystemiterator.getflags.html
    • /usr/share/doc/php-manual-en/filesystemiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/filesystemiterator.rewind.html
    • /usr/share/doc/php-manual-en/filesystemiterator.setflags.html
    • /usr/share/doc/php-manual-en/filter.configuration.html
    • /usr/share/doc/php-manual-en/filter.constants.html
    • /usr/share/doc/php-manual-en/filter.examples.html
    • /usr/share/doc/php-manual-en/filter.examples.sanitization.html
    • /usr/share/doc/php-manual-en/filter.examples.validation.html
    • /usr/share/doc/php-manual-en/filter.filters.flags.html
    • /usr/share/doc/php-manual-en/filter.filters.html
    • /usr/share/doc/php-manual-en/filter.filters.misc.html
    • /usr/share/doc/php-manual-en/filter.filters.sanitize.html
    • /usr/share/doc/php-manual-en/filter.filters.validate.html
    • /usr/share/doc/php-manual-en/filter.installation.html
    • /usr/share/doc/php-manual-en/filter.requirements.html
    • /usr/share/doc/php-manual-en/filter.resources.html
    • /usr/share/doc/php-manual-en/filter.setup.html
    • /usr/share/doc/php-manual-en/filteriterator.accept.html
    • /usr/share/doc/php-manual-en/filteriterator.construct.html
    • /usr/share/doc/php-manual-en/filteriterator.current.html
    • /usr/share/doc/php-manual-en/filteriterator.getinneriterator.html
    • /usr/share/doc/php-manual-en/filteriterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/filteriterator.rewind.html
    • /usr/share/doc/php-manual-en/filteriterator.valid.html
    • /usr/share/doc/php-manual-en/filters.compression.html
    • /usr/share/doc/php-manual-en/filters.convert.html
    • /usr/share/doc/php-manual-en/filters.encryption.html
    • /usr/share/doc/php-manual-en/filters.html
    • /usr/share/doc/php-manual-en/filters.string.html
    • /usr/share/doc/php-manual-en/fpm.setup.html
    • /usr/share/doc/php-manual-en/fribidi.configuration.html
    • /usr/share/doc/php-manual-en/fribidi.constants.html
    • /usr/share/doc/php-manual-en/fribidi.installation.html
    • /usr/share/doc/php-manual-en/fribidi.requirements.html
    • /usr/share/doc/php-manual-en/fribidi.resources.html
    • /usr/share/doc/php-manual-en/fribidi.setup.html
    • /usr/share/doc/php-manual-en/ftp.configuration.html
    • /usr/share/doc/php-manual-en/ftp.constants.html
    • /usr/share/doc/php-manual-en/ftp.examples-basic.html
    • /usr/share/doc/php-manual-en/ftp.examples.html
    • /usr/share/doc/php-manual-en/ftp.installation.html
    • /usr/share/doc/php-manual-en/ftp.requirements.html
    • /usr/share/doc/php-manual-en/ftp.resources.html
    • /usr/share/doc/php-manual-en/ftp.setup.html
    • /usr/share/doc/php-manual-en/funchand.configuration.html
    • /usr/share/doc/php-manual-en/funchand.constants.html
    • /usr/share/doc/php-manual-en/funchand.installation.html
    • /usr/share/doc/php-manual-en/funchand.requirements.html
    • /usr/share/doc/php-manual-en/funchand.resources.html
    • /usr/share/doc/php-manual-en/funchand.setup.html
    • /usr/share/doc/php-manual-en/funcref.html
    • /usr/share/doc/php-manual-en/function.abs.html
    • /usr/share/doc/php-manual-en/function.acos.html
    • /usr/share/doc/php-manual-en/function.acosh.html
    • /usr/share/doc/php-manual-en/function.addcslashes.html
    • /usr/share/doc/php-manual-en/function.addslashes.html
    • /usr/share/doc/php-manual-en/function.aggregate-info.html
    • /usr/share/doc/php-manual-en/function.aggregate-methods-by-list.html
    • /usr/share/doc/php-manual-en/function.aggregate-methods-by-regexp.html
    • /usr/share/doc/php-manual-en/function.aggregate-methods.html
    • /usr/share/doc/php-manual-en/function.aggregate-properties-by-list.html
    • /usr/share/doc/php-manual-en/function.aggregate-properties-by-regexp.html
    • /usr/share/doc/php-manual-en/function.aggregate-properties.html
    • /usr/share/doc/php-manual-en/function.aggregate.html
    • /usr/share/doc/php-manual-en/function.aggregation-info.html
    • /usr/share/doc/php-manual-en/function.apache-child-terminate.html
    • /usr/share/doc/php-manual-en/function.apache-get-modules.html
    • /usr/share/doc/php-manual-en/function.apache-get-version.html
    • /usr/share/doc/php-manual-en/function.apache-getenv.html
    • /usr/share/doc/php-manual-en/function.apache-lookup-uri.html
    • /usr/share/doc/php-manual-en/function.apache-note.html
    • /usr/share/doc/php-manual-en/function.apache-request-headers.html
    • /usr/share/doc/php-manual-en/function.apache-reset-timeout.html
    • /usr/share/doc/php-manual-en/function.apache-response-headers.html
    • /usr/share/doc/php-manual-en/function.apache-setenv.html
    • /usr/share/doc/php-manual-en/function.apc-add.html
    • /usr/share/doc/php-manual-en/function.apc-bin-dump.html
    • /usr/share/doc/php-manual-en/function.apc-bin-dumpfile.html
    • /usr/share/doc/php-manual-en/function.apc-bin-load.html
    • /usr/share/doc/php-manual-en/function.apc-bin-loadfile.html
    • /usr/share/doc/php-manual-en/function.apc-cache-info.html
    • /usr/share/doc/php-manual-en/function.apc-cas.html
    • /usr/share/doc/php-manual-en/function.apc-clear-cache.html
    • /usr/share/doc/php-manual-en/function.apc-compile-file.html
    • /usr/share/doc/php-manual-en/function.apc-dec.html
    • /usr/share/doc/php-manual-en/function.apc-define-constants.html
    • /usr/share/doc/php-manual-en/function.apc-delete-file.html
    • /usr/share/doc/php-manual-en/function.apc-delete.html
    • /usr/share/doc/php-manual-en/function.apc-exists.html
    • /usr/share/doc/php-manual-en/function.apc-fetch.html
    • /usr/share/doc/php-manual-en/function.apc-inc.html
    • /usr/share/doc/php-manual-en/function.apc-load-constants.html
    • /usr/share/doc/php-manual-en/function.apc-sma-info.html
    • /usr/share/doc/php-manual-en/function.apc-store.html
    • /usr/share/doc/php-manual-en/function.apd-breakpoint.html
    • /usr/share/doc/php-manual-en/function.apd-callstack.html
    • /usr/share/doc/php-manual-en/function.apd-clunk.html
    • /usr/share/doc/php-manual-en/function.apd-continue.html
    • /usr/share/doc/php-manual-en/function.apd-croak.html
    • /usr/share/doc/php-manual-en/function.apd-dump-function-table.html
    • /usr/share/doc/php-manual-en/function.apd-dump-persistent-resources.html
    • /usr/share/doc/php-manual-en/function.apd-dump-regular-resources.html
    • /usr/share/doc/php-manual-en/function.apd-echo.html
    • /usr/share/doc/php-manual-en/function.apd-get-active-symbols.html
    • /usr/share/doc/php-manual-en/function.apd-set-pprof-trace.html
    • /usr/share/doc/php-manual-en/function.apd-set-session-trace-socket.html
    • /usr/share/doc/php-manual-en/function.apd-set-session-trace.html
    • /usr/share/doc/php-manual-en/function.apd-set-session.html
    • /usr/share/doc/php-manual-en/function.array-change-key-case.html
    • /usr/share/doc/php-manual-en/function.array-chunk.html
    • /usr/share/doc/php-manual-en/function.array-column.html
    • /usr/share/doc/php-manual-en/function.array-combine.html
    • /usr/share/doc/php-manual-en/function.array-count-values.html
    • /usr/share/doc/php-manual-en/function.array-diff-assoc.html
    • /usr/share/doc/php-manual-en/function.array-diff-key.html
    • /usr/share/doc/php-manual-en/function.array-diff-uassoc.html
    • /usr/share/doc/php-manual-en/function.array-diff-ukey.html
    • /usr/share/doc/php-manual-en/function.array-diff.html
    • /usr/share/doc/php-manual-en/function.array-fill-keys.html
    • /usr/share/doc/php-manual-en/function.array-fill.html
    • /usr/share/doc/php-manual-en/function.array-filter.html
    • /usr/share/doc/php-manual-en/function.array-flip.html
    • /usr/share/doc/php-manual-en/function.array-intersect-assoc.html
    • /usr/share/doc/php-manual-en/function.array-intersect-key.html
    • /usr/share/doc/php-manual-en/function.array-intersect-uassoc.html
    • /usr/share/doc/php-manual-en/function.array-intersect-ukey.html
    • /usr/share/doc/php-manual-en/function.array-intersect.html
    • /usr/share/doc/php-manual-en/function.array-key-exists.html
    • /usr/share/doc/php-manual-en/function.array-keys.html
    • /usr/share/doc/php-manual-en/function.array-map.html
    • /usr/share/doc/php-manual-en/function.array-merge-recursive.html
    • /usr/share/doc/php-manual-en/function.array-merge.html
    • /usr/share/doc/php-manual-en/function.array-multisort.html
    • /usr/share/doc/php-manual-en/function.array-pad.html
    • /usr/share/doc/php-manual-en/function.array-pop.html
    • /usr/share/doc/php-manual-en/function.array-product.html
    • /usr/share/doc/php-manual-en/function.array-push.html
    • /usr/share/doc/php-manual-en/function.array-rand.html
    • /usr/share/doc/php-manual-en/function.array-reduce.html
    • /usr/share/doc/php-manual-en/function.array-replace-recursive.html
    • /usr/share/doc/php-manual-en/function.array-replace.html
    • /usr/share/doc/php-manual-en/function.array-reverse.html
    • /usr/share/doc/php-manual-en/function.array-search.html
    • /usr/share/doc/php-manual-en/function.array-shift.html
    • /usr/share/doc/php-manual-en/function.array-slice.html
    • /usr/share/doc/php-manual-en/function.array-splice.html
    • /usr/share/doc/php-manual-en/function.array-sum.html
    • /usr/share/doc/php-manual-en/function.array-udiff-assoc.html
    • /usr/share/doc/php-manual-en/function.array-udiff-uassoc.html
    • /usr/share/doc/php-manual-en/function.array-udiff.html
    • /usr/share/doc/php-manual-en/function.array-uintersect-assoc.html
    • /usr/share/doc/php-manual-en/function.array-uintersect-uassoc.html
    • /usr/share/doc/php-manual-en/function.array-uintersect.html
    • /usr/share/doc/php-manual-en/function.array-unique.html
    • /usr/share/doc/php-manual-en/function.array-unshift.html
    • /usr/share/doc/php-manual-en/function.array-values.html
    • /usr/share/doc/php-manual-en/function.array-walk-recursive.html
    • /usr/share/doc/php-manual-en/function.array-walk.html
    • /usr/share/doc/php-manual-en/function.array.html
    • /usr/share/doc/php-manual-en/function.arsort.html
    • /usr/share/doc/php-manual-en/function.asin.html
    • /usr/share/doc/php-manual-en/function.asinh.html
    • /usr/share/doc/php-manual-en/function.asort.html
    • /usr/share/doc/php-manual-en/function.assert-options.html
    • /usr/share/doc/php-manual-en/function.assert.html
    • /usr/share/doc/php-manual-en/function.atan.html
    • /usr/share/doc/php-manual-en/function.atan2.html
    • /usr/share/doc/php-manual-en/function.atanh.html
    • /usr/share/doc/php-manual-en/function.autoload.html
    • /usr/share/doc/php-manual-en/function.base-convert.html
    • /usr/share/doc/php-manual-en/function.base64-decode.html
    • /usr/share/doc/php-manual-en/function.base64-encode.html
    • /usr/share/doc/php-manual-en/function.basename.html
    • /usr/share/doc/php-manual-en/function.bbcode-add-element.html
    • /usr/share/doc/php-manual-en/function.bbcode-add-smiley.html
    • /usr/share/doc/php-manual-en/function.bbcode-create.html
    • /usr/share/doc/php-manual-en/function.bbcode-destroy.html
    • /usr/share/doc/php-manual-en/function.bbcode-parse.html
    • /usr/share/doc/php-manual-en/function.bbcode-set-arg-parser.html
    • /usr/share/doc/php-manual-en/function.bbcode-set-flags.html
    • /usr/share/doc/php-manual-en/function.bcadd.html
    • /usr/share/doc/php-manual-en/function.bccomp.html
    • /usr/share/doc/php-manual-en/function.bcdiv.html
    • /usr/share/doc/php-manual-en/function.bcmod.html
    • /usr/share/doc/php-manual-en/function.bcmul.html
    • /usr/share/doc/php-manual-en/function.bcompiler-load-exe.html
    • /usr/share/doc/php-manual-en/function.bcompiler-load.html
    • /usr/share/doc/php-manual-en/function.bcompiler-parse-class.html
    • /usr/share/doc/php-manual-en/function.bcompiler-read.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-class.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-constant.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-exe-footer.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-file.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-footer.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-function.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-functions-from-file.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-header.html
    • /usr/share/doc/php-manual-en/function.bcompiler-write-included-filename.html
    • /usr/share/doc/php-manual-en/function.bcpow.html
    • /usr/share/doc/php-manual-en/function.bcpowmod.html
    • /usr/share/doc/php-manual-en/function.bcscale.html
    • /usr/share/doc/php-manual-en/function.bcsqrt.html
    • /usr/share/doc/php-manual-en/function.bcsub.html
    • /usr/share/doc/php-manual-en/function.bin2hex.html
    • /usr/share/doc/php-manual-en/function.bind-textdomain-codeset.html
    • /usr/share/doc/php-manual-en/function.bindec.html
    • /usr/share/doc/php-manual-en/function.bindtextdomain.html
    • /usr/share/doc/php-manual-en/function.blenc-encrypt.html
    • /usr/share/doc/php-manual-en/function.boolval.html
    • /usr/share/doc/php-manual-en/function.bson-decode.html
    • /usr/share/doc/php-manual-en/function.bson-encode.html
    • /usr/share/doc/php-manual-en/function.bzclose.html
    • /usr/share/doc/php-manual-en/function.bzcompress.html
    • /usr/share/doc/php-manual-en/function.bzdecompress.html
    • /usr/share/doc/php-manual-en/function.bzerrno.html
    • /usr/share/doc/php-manual-en/function.bzerror.html
    • /usr/share/doc/php-manual-en/function.bzerrstr.html
    • /usr/share/doc/php-manual-en/function.bzflush.html
    • /usr/share/doc/php-manual-en/function.bzopen.html
    • /usr/share/doc/php-manual-en/function.bzread.html
    • /usr/share/doc/php-manual-en/function.bzwrite.html
    • /usr/share/doc/php-manual-en/function.cairo-create.html
    • /usr/share/doc/php-manual-en/function.cairo-font-face-get-type.html
    • /usr/share/doc/php-manual-en/function.cairo-font-face-status.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-create.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-equal.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-get-antialias.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-get-hint-metrics.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-get-hint-style.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-get-subpixel-order.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-hash.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-merge.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-set-antialias.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-set-hint-metrics.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-set-hint-style.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-set-subpixel-order.html
    • /usr/share/doc/php-manual-en/function.cairo-font-options-status.html
    • /usr/share/doc/php-manual-en/function.cairo-format-stride-for-width.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-create-for-data.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-create-from-png.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-create.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-get-data.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-get-format.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-get-height.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-get-stride.html
    • /usr/share/doc/php-manual-en/function.cairo-image-surface-get-width.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-create-scale.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-create-translate.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-invert.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-multiply.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-rotate.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-transform-distance.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-transform-point.html
    • /usr/share/doc/php-manual-en/function.cairo-matrix-translate.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-add-color-stop-rgb.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-add-color-stop-rgba.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-create-for-surface.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-create-linear.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-create-radial.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-create-rgb.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-create-rgba.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-color-stop-count.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-color-stop-rgba.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-extend.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-filter.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-linear-points.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-matrix.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-radial-circles.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-rgba.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-surface.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-get-type.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-set-extend.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-set-filter.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-set-matrix.html
    • /usr/share/doc/php-manual-en/function.cairo-pattern-status.html
    • /usr/share/doc/php-manual-en/function.cairo-pdf-surface-create.html
    • /usr/share/doc/php-manual-en/function.cairo-pdf-surface-set-size.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-get-levels.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-level-to-string.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-create.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-dsc-begin-page-setup.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-dsc-begin-setup.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-dsc-comment.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-get-eps.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-restrict-to-level.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-set-eps.html
    • /usr/share/doc/php-manual-en/function.cairo-ps-surface-set-size.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-create.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-extents.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-ctm.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-font-face.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-font-matrix.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-font-options.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-scale-matrix.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-get-type.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-glyph-extents.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-status.html
    • /usr/share/doc/php-manual-en/function.cairo-scaled-font-text-extents.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-copy-page.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-create-similar.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-finish.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-flush.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-get-content.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-get-device-offset.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-get-font-options.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-get-type.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-mark-dirty-rectangle.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-mark-dirty.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-set-device-offset.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-set-fallback-resolution.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-show-page.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-status.html
    • /usr/share/doc/php-manual-en/function.cairo-surface-write-to-png.html
    • /usr/share/doc/php-manual-en/function.cairo-svg-surface-create.html
    • /usr/share/doc/php-manual-en/function.cairo-svg-surface-restrict-to-version.html
    • /usr/share/doc/php-manual-en/function.cairo-svg-version-to-string.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.calcul-hmac.html
    • /usr/share/doc/php-manual-en/function.calculhmac.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.ceil.html
    • /usr/share/doc/php-manual-en/function.chdb-create.html
    • /usr/share/doc/php-manual-en/function.chdir.html
    • /usr/share/doc/php-manual-en/function.checkdate.html
    • /usr/share/doc/php-manual-en/function.checkdnsrr.html
    • /usr/share/doc/php-manual-en/function.chgrp.html
    • /usr/share/doc/php-manual-en/function.chmod.html
    • /usr/share/doc/php-manual-en/function.chop.html
    • /usr/share/doc/php-manual-en/function.chown.html
    • /usr/share/doc/php-manual-en/function.chr.html
    • /usr/share/doc/php-manual-en/function.chroot.html
    • /usr/share/doc/php-manual-en/function.chunk-split.html
    • /usr/share/doc/php-manual-en/function.class-alias.html
    • /usr/share/doc/php-manual-en/function.class-exists.html
    • /usr/share/doc/php-manual-en/function.class-implements.html
    • /usr/share/doc/php-manual-en/function.class-parents.html
    • /usr/share/doc/php-manual-en/function.class-uses.html
    • /usr/share/doc/php-manual-en/function.classkit-import.html
    • /usr/share/doc/php-manual-en/function.classkit-method-add.html
    • /usr/share/doc/php-manual-en/function.classkit-method-copy.html
    • /usr/share/doc/php-manual-en/function.classkit-method-redefine.html
    • /usr/share/doc/php-manual-en/function.classkit-method-remove.html
    • /usr/share/doc/php-manual-en/function.classkit-method-rename.html
    • /usr/share/doc/php-manual-en/function.clearstatcache.html
    • /usr/share/doc/php-manual-en/function.cli-get-process-title.html
    • /usr/share/doc/php-manual-en/function.cli-set-process-title.html
    • /usr/share/doc/php-manual-en/function.closedir.html
    • /usr/share/doc/php-manual-en/function.closelog.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.compact.html
    • /usr/share/doc/php-manual-en/function.connection-aborted.html
    • /usr/share/doc/php-manual-en/function.connection-status.html
    • /usr/share/doc/php-manual-en/function.connection-timeout.html
    • /usr/share/doc/php-manual-en/function.constant.html
    • /usr/share/doc/php-manual-en/function.convert-cyr-string.html
    • /usr/share/doc/php-manual-en/function.convert-uudecode.html
    • /usr/share/doc/php-manual-en/function.convert-uuencode.html
    • /usr/share/doc/php-manual-en/function.copy.html
    • /usr/share/doc/php-manual-en/function.cos.html
    • /usr/share/doc/php-manual-en/function.cosh.html
    • /usr/share/doc/php-manual-en/function.count-chars.html
    • /usr/share/doc/php-manual-en/function.count.html
    • /usr/share/doc/php-manual-en/function.crack-check.html
    • /usr/share/doc/php-manual-en/function.crack-closedict.html
    • /usr/share/doc/php-manual-en/function.crack-getlastmessage.html
    • /usr/share/doc/php-manual-en/function.crack-opendict.html
    • /usr/share/doc/php-manual-en/function.crc32.html
    • /usr/share/doc/php-manual-en/function.create-function.html
    • /usr/share/doc/php-manual-en/function.crypt.html
    • /usr/share/doc/php-manual-en/function.ctype-alnum.html
    • /usr/share/doc/php-manual-en/function.ctype-alpha.html
    • /usr/share/doc/php-manual-en/function.ctype-cntrl.html
    • /usr/share/doc/php-manual-en/function.ctype-digit.html
    • /usr/share/doc/php-manual-en/function.ctype-graph.html
    • /usr/share/doc/php-manual-en/function.ctype-lower.html
    • /usr/share/doc/php-manual-en/function.ctype-print.html
    • /usr/share/doc/php-manual-en/function.ctype-punct.html
    • /usr/share/doc/php-manual-en/function.ctype-space.html
    • /usr/share/doc/php-manual-en/function.ctype-upper.html
    • /usr/share/doc/php-manual-en/function.ctype-xdigit.html
    • /usr/share/doc/php-manual-en/function.cubrid-affected-rows.html
    • /usr/share/doc/php-manual-en/function.cubrid-bind.html
    • /usr/share/doc/php-manual-en/function.cubrid-client-encoding.html
    • /usr/share/doc/php-manual-en/function.cubrid-close-prepare.html
    • /usr/share/doc/php-manual-en/function.cubrid-close-request.html
    • /usr/share/doc/php-manual-en/function.cubrid-close.html
    • /usr/share/doc/php-manual-en/function.cubrid-col-get.html
    • /usr/share/doc/php-manual-en/function.cubrid-col-size.html
    • /usr/share/doc/php-manual-en/function.cubrid-column-names.html
    • /usr/share/doc/php-manual-en/function.cubrid-column-types.html
    • /usr/share/doc/php-manual-en/function.cubrid-commit.html
    • /usr/share/doc/php-manual-en/function.cubrid-connect-with-url.html
    • /usr/share/doc/php-manual-en/function.cubrid-connect.html
    • /usr/share/doc/php-manual-en/function.cubrid-current-oid.html
    • /usr/share/doc/php-manual-en/function.cubrid-data-seek.html
    • /usr/share/doc/php-manual-en/function.cubrid-db-name.html
    • /usr/share/doc/php-manual-en/function.cubrid-disconnect.html
    • /usr/share/doc/php-manual-en/function.cubrid-drop.html
    • /usr/share/doc/php-manual-en/function.cubrid-errno.html
    • /usr/share/doc/php-manual-en/function.cubrid-error-code-facility.html
    • /usr/share/doc/php-manual-en/function.cubrid-error-code.html
    • /usr/share/doc/php-manual-en/function.cubrid-error-msg.html
    • /usr/share/doc/php-manual-en/function.cubrid-error.html
    • /usr/share/doc/php-manual-en/function.cubrid-execute.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-array.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-field.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-lengths.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-object.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch-row.html
    • /usr/share/doc/php-manual-en/function.cubrid-fetch.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-flags.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-len.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-name.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-seek.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-table.html
    • /usr/share/doc/php-manual-en/function.cubrid-field-type.html
    • /usr/share/doc/php-manual-en/function.cubrid-free-result.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-autocommit.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-charset.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-class-name.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-client-info.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-db-parameter.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-query-timeout.html
    • /usr/share/doc/php-manual-en/function.cubrid-get-server-info.html
    • /usr/share/doc/php-manual-en/function.cubrid-get.html
    • /usr/share/doc/php-manual-en/function.cubrid-insert-id.html
    • /usr/share/doc/php-manual-en/function.cubrid-is-instance.html
    • /usr/share/doc/php-manual-en/function.cubrid-list-dbs.html
    • /usr/share/doc/php-manual-en/function.cubrid-load-from-glo.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob-close.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob-export.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob-get.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob-send.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob-size.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-bind.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-close.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-export.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-import.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-new.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-read.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-seek.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-seek64.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-size.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-size64.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-tell.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-tell64.html
    • /usr/share/doc/php-manual-en/function.cubrid-lob2-write.html
    • /usr/share/doc/php-manual-en/function.cubrid-lock-read.html
    • /usr/share/doc/php-manual-en/function.cubrid-lock-write.html
    • /usr/share/doc/php-manual-en/function.cubrid-move-cursor.html
    • /usr/share/doc/php-manual-en/function.cubrid-new-glo.html
    • /usr/share/doc/php-manual-en/function.cubrid-next-result.html
    • /usr/share/doc/php-manual-en/function.cubrid-num-cols.html
    • /usr/share/doc/php-manual-en/function.cubrid-num-fields.html
    • /usr/share/doc/php-manual-en/function.cubrid-num-rows.html
    • /usr/share/doc/php-manual-en/function.cubrid-pconnect-with-url.html
    • /usr/share/doc/php-manual-en/function.cubrid-pconnect.html
    • /usr/share/doc/php-manual-en/function.cubrid-ping.html
    • /usr/share/doc/php-manual-en/function.cubrid-prepare.html
    • /usr/share/doc/php-manual-en/function.cubrid-put.html
    • /usr/share/doc/php-manual-en/function.cubrid-query.html
    • /usr/share/doc/php-manual-en/function.cubrid-real-escape-string.html
    • /usr/share/doc/php-manual-en/function.cubrid-result.html
    • /usr/share/doc/php-manual-en/function.cubrid-rollback.html
    • /usr/share/doc/php-manual-en/function.cubrid-save-to-glo.html
    • /usr/share/doc/php-manual-en/function.cubrid-schema.html
    • /usr/share/doc/php-manual-en/function.cubrid-send-glo.html
    • /usr/share/doc/php-manual-en/function.cubrid-seq-drop.html
    • /usr/share/doc/php-manual-en/function.cubrid-seq-insert.html
    • /usr/share/doc/php-manual-en/function.cubrid-seq-put.html
    • /usr/share/doc/php-manual-en/function.cubrid-set-add.html
    • /usr/share/doc/php-manual-en/function.cubrid-set-autocommit.html
    • /usr/share/doc/php-manual-en/function.cubrid-set-db-parameter.html
    • /usr/share/doc/php-manual-en/function.cubrid-set-drop.html
    • /usr/share/doc/php-manual-en/function.cubrid-set-query-timeout.html
    • /usr/share/doc/php-manual-en/function.cubrid-unbuffered-query.html
    • /usr/share/doc/php-manual-en/function.cubrid-version.html
    • /usr/share/doc/php-manual-en/function.curl-close.html
    • /usr/share/doc/php-manual-en/function.curl-copy-handle.html
    • /usr/share/doc/php-manual-en/function.curl-errno.html
    • /usr/share/doc/php-manual-en/function.curl-error.html
    • /usr/share/doc/php-manual-en/function.curl-escape.html
    • /usr/share/doc/php-manual-en/function.curl-exec.html
    • /usr/share/doc/php-manual-en/function.curl-file-create.html
    • /usr/share/doc/php-manual-en/function.curl-getinfo.html
    • /usr/share/doc/php-manual-en/function.curl-init.html
    • /usr/share/doc/php-manual-en/function.curl-multi-add-handle.html
    • /usr/share/doc/php-manual-en/function.curl-multi-close.html
    • /usr/share/doc/php-manual-en/function.curl-multi-exec.html
    • /usr/share/doc/php-manual-en/function.curl-multi-getcontent.html
    • /usr/share/doc/php-manual-en/function.curl-multi-info-read.html
    • /usr/share/doc/php-manual-en/function.curl-multi-init.html
    • /usr/share/doc/php-manual-en/function.curl-multi-remove-handle.html
    • /usr/share/doc/php-manual-en/function.curl-multi-select.html
    • /usr/share/doc/php-manual-en/function.curl-multi-setopt.html
    • /usr/share/doc/php-manual-en/function.curl-multi-strerror.html
    • /usr/share/doc/php-manual-en/function.curl-pause.html
    • /usr/share/doc/php-manual-en/function.curl-reset.html
    • /usr/share/doc/php-manual-en/function.curl-setopt-array.html
    • /usr/share/doc/php-manual-en/function.curl-setopt.html
    • /usr/share/doc/php-manual-en/function.curl-share-close.html
    • /usr/share/doc/php-manual-en/function.curl-share-init.html
    • /usr/share/doc/php-manual-en/function.curl-share-setopt.html
    • /usr/share/doc/php-manual-en/function.curl-strerror.html
    • /usr/share/doc/php-manual-en/function.curl-unescape.html
    • /usr/share/doc/php-manual-en/function.curl-version.html
    • /usr/share/doc/php-manual-en/function.current.html
    • /usr/share/doc/php-manual-en/function.cyrus-authenticate.html
    • /usr/share/doc/php-manual-en/function.cyrus-bind.html
    • /usr/share/doc/php-manual-en/function.cyrus-close.html
    • /usr/share/doc/php-manual-en/function.cyrus-connect.html
    • /usr/share/doc/php-manual-en/function.cyrus-query.html
    • /usr/share/doc/php-manual-en/function.cyrus-unbind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.db2-autocommit.html
    • /usr/share/doc/php-manual-en/function.db2-bind-param.html
    • /usr/share/doc/php-manual-en/function.db2-client-info.html
    • /usr/share/doc/php-manual-en/function.db2-close.html
    • /usr/share/doc/php-manual-en/function.db2-column-privileges.html
    • /usr/share/doc/php-manual-en/function.db2-columns.html
    • /usr/share/doc/php-manual-en/function.db2-commit.html
    • /usr/share/doc/php-manual-en/function.db2-conn-error.html
    • /usr/share/doc/php-manual-en/function.db2-conn-errormsg.html
    • /usr/share/doc/php-manual-en/function.db2-connect.html
    • /usr/share/doc/php-manual-en/function.db2-cursor-type.html
    • /usr/share/doc/php-manual-en/function.db2-escape-string.html
    • /usr/share/doc/php-manual-en/function.db2-exec.html
    • /usr/share/doc/php-manual-en/function.db2-execute.html
    • /usr/share/doc/php-manual-en/function.db2-fetch-array.html
    • /usr/share/doc/php-manual-en/function.db2-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.db2-fetch-both.html
    • /usr/share/doc/php-manual-en/function.db2-fetch-object.html
    • /usr/share/doc/php-manual-en/function.db2-fetch-row.html
    • /usr/share/doc/php-manual-en/function.db2-field-display-size.html
    • /usr/share/doc/php-manual-en/function.db2-field-name.html
    • /usr/share/doc/php-manual-en/function.db2-field-num.html
    • /usr/share/doc/php-manual-en/function.db2-field-precision.html
    • /usr/share/doc/php-manual-en/function.db2-field-scale.html
    • /usr/share/doc/php-manual-en/function.db2-field-type.html
    • /usr/share/doc/php-manual-en/function.db2-field-width.html
    • /usr/share/doc/php-manual-en/function.db2-foreign-keys.html
    • /usr/share/doc/php-manual-en/function.db2-free-result.html
    • /usr/share/doc/php-manual-en/function.db2-free-stmt.html
    • /usr/share/doc/php-manual-en/function.db2-get-option.html
    • /usr/share/doc/php-manual-en/function.db2-last-insert-id.html
    • /usr/share/doc/php-manual-en/function.db2-lob-read.html
    • /usr/share/doc/php-manual-en/function.db2-next-result.html
    • /usr/share/doc/php-manual-en/function.db2-num-fields.html
    • /usr/share/doc/php-manual-en/function.db2-num-rows.html
    • /usr/share/doc/php-manual-en/function.db2-pclose.html
    • /usr/share/doc/php-manual-en/function.db2-pconnect.html
    • /usr/share/doc/php-manual-en/function.db2-prepare.html
    • /usr/share/doc/php-manual-en/function.db2-primary-keys.html
    • /usr/share/doc/php-manual-en/function.db2-procedure-columns.html
    • /usr/share/doc/php-manual-en/function.db2-procedures.html
    • /usr/share/doc/php-manual-en/function.db2-result.html
    • /usr/share/doc/php-manual-en/function.db2-rollback.html
    • /usr/share/doc/php-manual-en/function.db2-server-info.html
    • /usr/share/doc/php-manual-en/function.db2-set-option.html
    • /usr/share/doc/php-manual-en/function.db2-special-columns.html
    • /usr/share/doc/php-manual-en/function.db2-statistics.html
    • /usr/share/doc/php-manual-en/function.db2-stmt-error.html
    • /usr/share/doc/php-manual-en/function.db2-stmt-errormsg.html
    • /usr/share/doc/php-manual-en/function.db2-table-privileges.html
    • /usr/share/doc/php-manual-en/function.db2-tables.html
    • /usr/share/doc/php-manual-en/function.dba-close.html
    • /usr/share/doc/php-manual-en/function.dba-delete.html
    • /usr/share/doc/php-manual-en/function.dba-exists.html
    • /usr/share/doc/php-manual-en/function.dba-fetch.html
    • /usr/share/doc/php-manual-en/function.dba-firstkey.html
    • /usr/share/doc/php-manual-en/function.dba-handlers.html
    • /usr/share/doc/php-manual-en/function.dba-insert.html
    • /usr/share/doc/php-manual-en/function.dba-key-split.html
    • /usr/share/doc/php-manual-en/function.dba-list.html
    • /usr/share/doc/php-manual-en/function.dba-nextkey.html
    • /usr/share/doc/php-manual-en/function.dba-open.html
    • /usr/share/doc/php-manual-en/function.dba-optimize.html
    • /usr/share/doc/php-manual-en/function.dba-popen.html
    • /usr/share/doc/php-manual-en/function.dba-replace.html
    • /usr/share/doc/php-manual-en/function.dba-sync.html
    • /usr/share/doc/php-manual-en/function.dbase-add-record.html
    • /usr/share/doc/php-manual-en/function.dbase-close.html
    • /usr/share/doc/php-manual-en/function.dbase-create.html
    • /usr/share/doc/php-manual-en/function.dbase-delete-record.html
    • /usr/share/doc/php-manual-en/function.dbase-get-header-info.html
    • /usr/share/doc/php-manual-en/function.dbase-get-record-with-names.html
    • /usr/share/doc/php-manual-en/function.dbase-get-record.html
    • /usr/share/doc/php-manual-en/function.dbase-numfields.html
    • /usr/share/doc/php-manual-en/function.dbase-numrecords.html
    • /usr/share/doc/php-manual-en/function.dbase-open.html
    • /usr/share/doc/php-manual-en/function.dbase-pack.html
    • /usr/share/doc/php-manual-en/function.dbase-replace-record.html
    • /usr/share/doc/php-manual-en/function.dbplus-add.html
    • /usr/share/doc/php-manual-en/function.dbplus-aql.html
    • /usr/share/doc/php-manual-en/function.dbplus-chdir.html
    • /usr/share/doc/php-manual-en/function.dbplus-close.html
    • /usr/share/doc/php-manual-en/function.dbplus-curr.html
    • /usr/share/doc/php-manual-en/function.dbplus-errcode.html
    • /usr/share/doc/php-manual-en/function.dbplus-errno.html
    • /usr/share/doc/php-manual-en/function.dbplus-find.html
    • /usr/share/doc/php-manual-en/function.dbplus-first.html
    • /usr/share/doc/php-manual-en/function.dbplus-flush.html
    • /usr/share/doc/php-manual-en/function.dbplus-freealllocks.html
    • /usr/share/doc/php-manual-en/function.dbplus-freelock.html
    • /usr/share/doc/php-manual-en/function.dbplus-freerlocks.html
    • /usr/share/doc/php-manual-en/function.dbplus-getlock.html
    • /usr/share/doc/php-manual-en/function.dbplus-getunique.html
    • /usr/share/doc/php-manual-en/function.dbplus-info.html
    • /usr/share/doc/php-manual-en/function.dbplus-last.html
    • /usr/share/doc/php-manual-en/function.dbplus-lockrel.html
    • /usr/share/doc/php-manual-en/function.dbplus-next.html
    • /usr/share/doc/php-manual-en/function.dbplus-open.html
    • /usr/share/doc/php-manual-en/function.dbplus-prev.html
    • /usr/share/doc/php-manual-en/function.dbplus-rchperm.html
    • /usr/share/doc/php-manual-en/function.dbplus-rcreate.html
    • /usr/share/doc/php-manual-en/function.dbplus-rcrtexact.html
    • /usr/share/doc/php-manual-en/function.dbplus-rcrtlike.html
    • /usr/share/doc/php-manual-en/function.dbplus-resolve.html
    • /usr/share/doc/php-manual-en/function.dbplus-restorepos.html
    • /usr/share/doc/php-manual-en/function.dbplus-rkeys.html
    • /usr/share/doc/php-manual-en/function.dbplus-ropen.html
    • /usr/share/doc/php-manual-en/function.dbplus-rquery.html
    • /usr/share/doc/php-manual-en/function.dbplus-rrename.html
    • /usr/share/doc/php-manual-en/function.dbplus-rsecindex.html
    • /usr/share/doc/php-manual-en/function.dbplus-runlink.html
    • /usr/share/doc/php-manual-en/function.dbplus-rzap.html
    • /usr/share/doc/php-manual-en/function.dbplus-savepos.html
    • /usr/share/doc/php-manual-en/function.dbplus-setindex.html
    • /usr/share/doc/php-manual-en/function.dbplus-setindexbynumber.html
    • /usr/share/doc/php-manual-en/function.dbplus-sql.html
    • /usr/share/doc/php-manual-en/function.dbplus-tcl.html
    • /usr/share/doc/php-manual-en/function.dbplus-tremove.html
    • /usr/share/doc/php-manual-en/function.dbplus-undo.html
    • /usr/share/doc/php-manual-en/function.dbplus-undoprepare.html
    • /usr/share/doc/php-manual-en/function.dbplus-unlockrel.html
    • /usr/share/doc/php-manual-en/function.dbplus-unselect.html
    • /usr/share/doc/php-manual-en/function.dbplus-update.html
    • /usr/share/doc/php-manual-en/function.dbplus-xlockrel.html
    • /usr/share/doc/php-manual-en/function.dbplus-xunlockrel.html
    • /usr/share/doc/php-manual-en/function.dbx-close.html
    • /usr/share/doc/php-manual-en/function.dbx-compare.html
    • /usr/share/doc/php-manual-en/function.dbx-connect.html
    • /usr/share/doc/php-manual-en/function.dbx-error.html
    • /usr/share/doc/php-manual-en/function.dbx-escape-string.html
    • /usr/share/doc/php-manual-en/function.dbx-fetch-row.html
    • /usr/share/doc/php-manual-en/function.dbx-query.html
    • /usr/share/doc/php-manual-en/function.dbx-sort.html
    • /usr/share/doc/php-manual-en/function.dcgettext.html
    • /usr/share/doc/php-manual-en/function.dcngettext.html
    • /usr/share/doc/php-manual-en/function.deaggregate.html
    • /usr/share/doc/php-manual-en/function.debug-backtrace.html
    • /usr/share/doc/php-manual-en/function.debug-print-backtrace.html
    • /usr/share/doc/php-manual-en/function.debug-zval-dump.html
    • /usr/share/doc/php-manual-en/function.decbin.html
    • /usr/share/doc/php-manual-en/function.dechex.html
    • /usr/share/doc/php-manual-en/function.decoct.html
    • /usr/share/doc/php-manual-en/function.define-syslog-variables.html
    • /usr/share/doc/php-manual-en/function.define.html
    • /usr/share/doc/php-manual-en/function.defined.html
    • /usr/share/doc/php-manual-en/function.deg2rad.html
    • /usr/share/doc/php-manual-en/function.delete.html
    • /usr/share/doc/php-manual-en/function.dgettext.html
    • /usr/share/doc/php-manual-en/function.die.html
    • /usr/share/doc/php-manual-en/function.dio-close.html
    • /usr/share/doc/php-manual-en/function.dio-fcntl.html
    • /usr/share/doc/php-manual-en/function.dio-open.html
    • /usr/share/doc/php-manual-en/function.dio-read.html
    • /usr/share/doc/php-manual-en/function.dio-seek.html
    • /usr/share/doc/php-manual-en/function.dio-stat.html
    • /usr/share/doc/php-manual-en/function.dio-tcsetattr.html
    • /usr/share/doc/php-manual-en/function.dio-truncate.html
    • /usr/share/doc/php-manual-en/function.dio-write.html
    • /usr/share/doc/php-manual-en/function.dir.html
    • /usr/share/doc/php-manual-en/function.dirname.html
    • /usr/share/doc/php-manual-en/function.disk-free-space.html
    • /usr/share/doc/php-manual-en/function.disk-total-space.html
    • /usr/share/doc/php-manual-en/function.diskfreespace.html
    • /usr/share/doc/php-manual-en/function.dl.html
    • /usr/share/doc/php-manual-en/function.dngettext.html
    • /usr/share/doc/php-manual-en/function.dns-check-record.html
    • /usr/share/doc/php-manual-en/function.dns-get-mx.html
    • /usr/share/doc/php-manual-en/function.dns-get-record.html
    • /usr/share/doc/php-manual-en/function.dom-import-simplexml.html
    • /usr/share/doc/php-manual-en/function.dotnet-load.html
    • /usr/share/doc/php-manual-en/function.doubleval.html
    • /usr/share/doc/php-manual-en/function.each.html
    • /usr/share/doc/php-manual-en/function.easter-date.html
    • /usr/share/doc/php-manual-en/function.easter-days.html
    • /usr/share/doc/php-manual-en/function.echo.html
    • /usr/share/doc/php-manual-en/function.eio-busy.html
    • /usr/share/doc/php-manual-en/function.eio-cancel.html
    • /usr/share/doc/php-manual-en/function.eio-chmod.html
    • /usr/share/doc/php-manual-en/function.eio-chown.html
    • /usr/share/doc/php-manual-en/function.eio-close.html
    • /usr/share/doc/php-manual-en/function.eio-custom.html
    • /usr/share/doc/php-manual-en/function.eio-dup2.html
    • /usr/share/doc/php-manual-en/function.eio-event-loop.html
    • /usr/share/doc/php-manual-en/function.eio-fallocate.html
    • /usr/share/doc/php-manual-en/function.eio-fchmod.html
    • /usr/share/doc/php-manual-en/function.eio-fchown.html
    • /usr/share/doc/php-manual-en/function.eio-fdatasync.html
    • /usr/share/doc/php-manual-en/function.eio-fstat.html
    • /usr/share/doc/php-manual-en/function.eio-fstatvfs.html
    • /usr/share/doc/php-manual-en/function.eio-fsync.html
    • /usr/share/doc/php-manual-en/function.eio-ftruncate.html
    • /usr/share/doc/php-manual-en/function.eio-futime.html
    • /usr/share/doc/php-manual-en/function.eio-get-event-stream.html
    • /usr/share/doc/php-manual-en/function.eio-get-last-error.html
    • /usr/share/doc/php-manual-en/function.eio-grp-add.html
    • /usr/share/doc/php-manual-en/function.eio-grp-cancel.html
    • /usr/share/doc/php-manual-en/function.eio-grp-limit.html
    • /usr/share/doc/php-manual-en/function.eio-grp.html
    • /usr/share/doc/php-manual-en/function.eio-init.html
    • /usr/share/doc/php-manual-en/function.eio-link.html
    • /usr/share/doc/php-manual-en/function.eio-lstat.html
    • /usr/share/doc/php-manual-en/function.eio-mkdir.html
    • /usr/share/doc/php-manual-en/function.eio-mknod.html
    • /usr/share/doc/php-manual-en/function.eio-nop.html
    • /usr/share/doc/php-manual-en/function.eio-npending.html
    • /usr/share/doc/php-manual-en/function.eio-nready.html
    • /usr/share/doc/php-manual-en/function.eio-nreqs.html
    • /usr/share/doc/php-manual-en/function.eio-nthreads.html
    • /usr/share/doc/php-manual-en/function.eio-open.html
    • /usr/share/doc/php-manual-en/function.eio-poll.html
    • /usr/share/doc/php-manual-en/function.eio-read.html
    • /usr/share/doc/php-manual-en/function.eio-readahead.html
    • /usr/share/doc/php-manual-en/function.eio-readdir.html
    • /usr/share/doc/php-manual-en/function.eio-readlink.html
    • /usr/share/doc/php-manual-en/function.eio-realpath.html
    • /usr/share/doc/php-manual-en/function.eio-rename.html
    • /usr/share/doc/php-manual-en/function.eio-rmdir.html
    • /usr/share/doc/php-manual-en/function.eio-seek.html
    • /usr/share/doc/php-manual-en/function.eio-sendfile.html
    • /usr/share/doc/php-manual-en/function.eio-set-max-idle.html
    • /usr/share/doc/php-manual-en/function.eio-set-max-parallel.html
    • /usr/share/doc/php-manual-en/function.eio-set-max-poll-reqs.html
    • /usr/share/doc/php-manual-en/function.eio-set-max-poll-time.html
    • /usr/share/doc/php-manual-en/function.eio-set-min-parallel.html
    • /usr/share/doc/php-manual-en/function.eio-stat.html
    • /usr/share/doc/php-manual-en/function.eio-statvfs.html
    • /usr/share/doc/php-manual-en/function.eio-symlink.html
    • /usr/share/doc/php-manual-en/function.eio-sync-file-range.html
    • /usr/share/doc/php-manual-en/function.eio-sync.html
    • /usr/share/doc/php-manual-en/function.eio-syncfs.html
    • /usr/share/doc/php-manual-en/function.eio-truncate.html
    • /usr/share/doc/php-manual-en/function.eio-unlink.html
    • /usr/share/doc/php-manual-en/function.eio-utime.html
    • /usr/share/doc/php-manual-en/function.eio-write.html
    • /usr/share/doc/php-manual-en/function.empty.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-describe.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-dict-exists.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-free-dict.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-free.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-get-error.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-init.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-list-dicts.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-request-dict.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-request-pwl-dict.html
    • /usr/share/doc/php-manual-en/function.enchant-broker-set-ordering.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-add-to-personal.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-add-to-session.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-check.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-describe.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-get-error.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-is-in-session.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-quick-check.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-store-replacement.html
    • /usr/share/doc/php-manual-en/function.enchant-dict-suggest.html
    • /usr/share/doc/php-manual-en/function.end.html
    • /usr/share/doc/php-manual-en/function.ereg-replace.html
    • /usr/share/doc/php-manual-en/function.ereg.html
    • /usr/share/doc/php-manual-en/function.eregi-replace.html
    • /usr/share/doc/php-manual-en/function.eregi.html
    • /usr/share/doc/php-manual-en/function.error-get-last.html
    • /usr/share/doc/php-manual-en/function.error-log.html
    • /usr/share/doc/php-manual-en/function.error-reporting.html
    • /usr/share/doc/php-manual-en/function.escapeshellarg.html
    • /usr/share/doc/php-manual-en/function.escapeshellcmd.html
    • /usr/share/doc/php-manual-en/function.eval.html
    • /usr/share/doc/php-manual-en/function.event-add.html
    • /usr/share/doc/php-manual-en/function.event-base-free.html
    • /usr/share/doc/php-manual-en/function.event-base-loop.html
    • /usr/share/doc/php-manual-en/function.event-base-loopbreak.html
    • /usr/share/doc/php-manual-en/function.event-base-loopexit.html
    • /usr/share/doc/php-manual-en/function.event-base-new.html
    • /usr/share/doc/php-manual-en/function.event-base-priority-init.html
    • /usr/share/doc/php-manual-en/function.event-base-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-base-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-disable.html
    • /usr/share/doc/php-manual-en/function.event-buffer-enable.html
    • /usr/share/doc/php-manual-en/function.event-buffer-fd-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-free.html
    • /usr/share/doc/php-manual-en/function.event-buffer-new.html
    • /usr/share/doc/php-manual-en/function.event-buffer-priority-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-read.html
    • /usr/share/doc/php-manual-en/function.event-buffer-set-callback.html
    • /usr/share/doc/php-manual-en/function.event-buffer-timeout-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-watermark-set.html
    • /usr/share/doc/php-manual-en/function.event-buffer-write.html
    • /usr/share/doc/php-manual-en/function.event-del.html
    • /usr/share/doc/php-manual-en/function.event-free.html
    • /usr/share/doc/php-manual-en/function.event-new.html
    • /usr/share/doc/php-manual-en/function.event-set.html
    • /usr/share/doc/php-manual-en/function.exec.html
    • /usr/share/doc/php-manual-en/function.exif-imagetype.html
    • /usr/share/doc/php-manual-en/function.exif-read-data.html
    • /usr/share/doc/php-manual-en/function.exif-tagname.html
    • /usr/share/doc/php-manual-en/function.exif-thumbnail.html
    • /usr/share/doc/php-manual-en/function.exit.html
    • /usr/share/doc/php-manual-en/function.exp.html
    • /usr/share/doc/php-manual-en/function.expect-expectl.html
    • /usr/share/doc/php-manual-en/function.expect-popen.html
    • /usr/share/doc/php-manual-en/function.explode.html
    • /usr/share/doc/php-manual-en/function.expm1.html
    • /usr/share/doc/php-manual-en/function.extension-loaded.html
    • /usr/share/doc/php-manual-en/function.extract.html
    • /usr/share/doc/php-manual-en/function.ezmlm-hash.html
    • /usr/share/doc/php-manual-en/function.fam-cancel-monitor.html
    • /usr/share/doc/php-manual-en/function.fam-close.html
    • /usr/share/doc/php-manual-en/function.fam-monitor-collection.html
    • /usr/share/doc/php-manual-en/function.fam-monitor-directory.html
    • /usr/share/doc/php-manual-en/function.fam-monitor-file.html
    • /usr/share/doc/php-manual-en/function.fam-next-event.html
    • /usr/share/doc/php-manual-en/function.fam-open.html
    • /usr/share/doc/php-manual-en/function.fam-pending.html
    • /usr/share/doc/php-manual-en/function.fam-resume-monitor.html
    • /usr/share/doc/php-manual-en/function.fam-suspend-monitor.html
    • /usr/share/doc/php-manual-en/function.fann-cascadetrain-on-data.html
    • /usr/share/doc/php-manual-en/function.fann-cascadetrain-on-file.html
    • /usr/share/doc/php-manual-en/function.fann-clear-scaling-params.html
    • /usr/share/doc/php-manual-en/function.fann-copy.html
    • /usr/share/doc/php-manual-en/function.fann-create-from-file.html
    • /usr/share/doc/php-manual-en/function.fann-create-shortcut-array.html
    • /usr/share/doc/php-manual-en/function.fann-create-shortcut.html
    • /usr/share/doc/php-manual-en/function.fann-create-sparse-array.html
    • /usr/share/doc/php-manual-en/function.fann-create-sparse.html
    • /usr/share/doc/php-manual-en/function.fann-create-standard-array.html
    • /usr/share/doc/php-manual-en/function.fann-create-standard.html
    • /usr/share/doc/php-manual-en/function.fann-create-train-from-callback.html
    • /usr/share/doc/php-manual-en/function.fann-create-train.html
    • /usr/share/doc/php-manual-en/function.fann-descale-input.html
    • /usr/share/doc/php-manual-en/function.fann-descale-output.html
    • /usr/share/doc/php-manual-en/function.fann-descale-train.html
    • /usr/share/doc/php-manual-en/function.fann-destroy-train.html
    • /usr/share/doc/php-manual-en/function.fann-destroy.html
    • /usr/share/doc/php-manual-en/function.fann-duplicate-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-get-activation-function.html
    • /usr/share/doc/php-manual-en/function.fann-get-activation-steepness.html
    • /usr/share/doc/php-manual-en/function.fann-get-bias-array.html
    • /usr/share/doc/php-manual-en/function.fann-get-bit-fail-limit.html
    • /usr/share/doc/php-manual-en/function.fann-get-bit-fail.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-activation-functions-count.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-activation-functions.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-activation-steepnesses-count.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-activation-steepnesses.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-candidate-change-fraction.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-candidate-limit.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-candidate-stagnation-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-max-cand-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-max-out-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-min-cand-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-min-out-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-num-candidate-groups.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-num-candidates.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-output-change-fraction.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-output-stagnation-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-get-cascade-weight-multiplier.html
    • /usr/share/doc/php-manual-en/function.fann-get-connection-array.html
    • /usr/share/doc/php-manual-en/function.fann-get-connection-rate.html
    • /usr/share/doc/php-manual-en/function.fann-get-errno.html
    • /usr/share/doc/php-manual-en/function.fann-get-errstr.html
    • /usr/share/doc/php-manual-en/function.fann-get-layer-array.html
    • /usr/share/doc/php-manual-en/function.fann-get-learning-momentum.html
    • /usr/share/doc/php-manual-en/function.fann-get-learning-rate.html
    • /usr/share/doc/php-manual-en/function.fann-get-mse.html
    • /usr/share/doc/php-manual-en/function.fann-get-network-type.html
    • /usr/share/doc/php-manual-en/function.fann-get-num-input.html
    • /usr/share/doc/php-manual-en/function.fann-get-num-layers.html
    • /usr/share/doc/php-manual-en/function.fann-get-num-output.html
    • /usr/share/doc/php-manual-en/function.fann-get-quickprop-decay.html
    • /usr/share/doc/php-manual-en/function.fann-get-quickprop-mu.html
    • /usr/share/doc/php-manual-en/function.fann-get-rprop-decrease-factor.html
    • /usr/share/doc/php-manual-en/function.fann-get-rprop-delta-max.html
    • /usr/share/doc/php-manual-en/function.fann-get-rprop-delta-min.html
    • /usr/share/doc/php-manual-en/function.fann-get-rprop-delta-zero.html
    • /usr/share/doc/php-manual-en/function.fann-get-rprop-increase-factor.html
    • /usr/share/doc/php-manual-en/function.fann-get-sarprop-step-error-shift.html
    • /usr/share/doc/php-manual-en/function.fann-get-sarprop-step-error-threshold-factor.html
    • /usr/share/doc/php-manual-en/function.fann-get-sarprop-temperature.html
    • /usr/share/doc/php-manual-en/function.fann-get-sarprop-weight-decay-shift.html
    • /usr/share/doc/php-manual-en/function.fann-get-total-connections.html
    • /usr/share/doc/php-manual-en/function.fann-get-total-neurons.html
    • /usr/share/doc/php-manual-en/function.fann-get-train-error-function.html
    • /usr/share/doc/php-manual-en/function.fann-get-train-stop-function.html
    • /usr/share/doc/php-manual-en/function.fann-get-training-algorithm.html
    • /usr/share/doc/php-manual-en/function.fann-init-weights.html
    • /usr/share/doc/php-manual-en/function.fann-length-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-merge-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-num-input-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-num-output-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-print-error.html
    • /usr/share/doc/php-manual-en/function.fann-randomize-weights.html
    • /usr/share/doc/php-manual-en/function.fann-read-train-from-file.html
    • /usr/share/doc/php-manual-en/function.fann-reset-errno.html
    • /usr/share/doc/php-manual-en/function.fann-reset-errstr.html
    • /usr/share/doc/php-manual-en/function.fann-reset-mse.html
    • /usr/share/doc/php-manual-en/function.fann-run.html
    • /usr/share/doc/php-manual-en/function.fann-save-train.html
    • /usr/share/doc/php-manual-en/function.fann-save.html
    • /usr/share/doc/php-manual-en/function.fann-scale-input-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-scale-input.html
    • /usr/share/doc/php-manual-en/function.fann-scale-output-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-scale-output.html
    • /usr/share/doc/php-manual-en/function.fann-scale-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-scale-train.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-function-hidden.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-function-layer.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-function-output.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-function.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-steepness-hidden.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-steepness-layer.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-steepness-output.html
    • /usr/share/doc/php-manual-en/function.fann-set-activation-steepness.html
    • /usr/share/doc/php-manual-en/function.fann-set-bit-fail-limit.html
    • /usr/share/doc/php-manual-en/function.fann-set-callback.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-activation-functions.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-activation-steepnesses.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-candidate-change-fraction.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-candidate-limit.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-candidate-stagnation-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-max-cand-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-max-out-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-min-cand-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-min-out-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-num-candidate-groups.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-output-change-fraction.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-output-stagnation-epochs.html
    • /usr/share/doc/php-manual-en/function.fann-set-cascade-weight-multiplier.html
    • /usr/share/doc/php-manual-en/function.fann-set-error-log.html
    • /usr/share/doc/php-manual-en/function.fann-set-input-scaling-params.html
    • /usr/share/doc/php-manual-en/function.fann-set-learning-momentum.html
    • /usr/share/doc/php-manual-en/function.fann-set-learning-rate.html
    • /usr/share/doc/php-manual-en/function.fann-set-output-scaling-params.html
    • /usr/share/doc/php-manual-en/function.fann-set-quickprop-decay.html
    • /usr/share/doc/php-manual-en/function.fann-set-quickprop-mu.html
    • /usr/share/doc/php-manual-en/function.fann-set-rprop-decrease-factor.html
    • /usr/share/doc/php-manual-en/function.fann-set-rprop-delta-max.html
    • /usr/share/doc/php-manual-en/function.fann-set-rprop-delta-min.html
    • /usr/share/doc/php-manual-en/function.fann-set-rprop-delta-zero.html
    • /usr/share/doc/php-manual-en/function.fann-set-rprop-increase-factor.html
    • /usr/share/doc/php-manual-en/function.fann-set-sarprop-step-error-shift.html
    • /usr/share/doc/php-manual-en/function.fann-set-sarprop-step-error-threshold-factor.html
    • /usr/share/doc/php-manual-en/function.fann-set-sarprop-temperature.html
    • /usr/share/doc/php-manual-en/function.fann-set-sarprop-weight-decay-shift.html
    • /usr/share/doc/php-manual-en/function.fann-set-scaling-params.html
    • /usr/share/doc/php-manual-en/function.fann-set-train-error-function.html
    • /usr/share/doc/php-manual-en/function.fann-set-train-stop-function.html
    • /usr/share/doc/php-manual-en/function.fann-set-training-algorithm.html
    • /usr/share/doc/php-manual-en/function.fann-set-weight-array.html
    • /usr/share/doc/php-manual-en/function.fann-set-weight.html
    • /usr/share/doc/php-manual-en/function.fann-shuffle-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-subset-train-data.html
    • /usr/share/doc/php-manual-en/function.fann-test-data.html
    • /usr/share/doc/php-manual-en/function.fann-test.html
    • /usr/share/doc/php-manual-en/function.fann-train-epoch.html
    • /usr/share/doc/php-manual-en/function.fann-train-on-data.html
    • /usr/share/doc/php-manual-en/function.fann-train-on-file.html
    • /usr/share/doc/php-manual-en/function.fann-train.html
    • /usr/share/doc/php-manual-en/function.fastcgi-finish-request.html
    • /usr/share/doc/php-manual-en/function.fbsql-affected-rows.html
    • /usr/share/doc/php-manual-en/function.fbsql-autocommit.html
    • /usr/share/doc/php-manual-en/function.fbsql-blob-size.html
    • /usr/share/doc/php-manual-en/function.fbsql-change-user.html
    • /usr/share/doc/php-manual-en/function.fbsql-clob-size.html
    • /usr/share/doc/php-manual-en/function.fbsql-close.html
    • /usr/share/doc/php-manual-en/function.fbsql-commit.html
    • /usr/share/doc/php-manual-en/function.fbsql-connect.html
    • /usr/share/doc/php-manual-en/function.fbsql-create-blob.html
    • /usr/share/doc/php-manual-en/function.fbsql-create-clob.html
    • /usr/share/doc/php-manual-en/function.fbsql-create-db.html
    • /usr/share/doc/php-manual-en/function.fbsql-data-seek.html
    • /usr/share/doc/php-manual-en/function.fbsql-database-password.html
    • /usr/share/doc/php-manual-en/function.fbsql-database.html
    • /usr/share/doc/php-manual-en/function.fbsql-db-query.html
    • /usr/share/doc/php-manual-en/function.fbsql-db-status.html
    • /usr/share/doc/php-manual-en/function.fbsql-drop-db.html
    • /usr/share/doc/php-manual-en/function.fbsql-errno.html
    • /usr/share/doc/php-manual-en/function.fbsql-error.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-array.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-field.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-lengths.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-object.html
    • /usr/share/doc/php-manual-en/function.fbsql-fetch-row.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-flags.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-len.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-name.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-seek.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-table.html
    • /usr/share/doc/php-manual-en/function.fbsql-field-type.html
    • /usr/share/doc/php-manual-en/function.fbsql-free-result.html
    • /usr/share/doc/php-manual-en/function.fbsql-get-autostart-info.html
    • /usr/share/doc/php-manual-en/function.fbsql-hostname.html
    • /usr/share/doc/php-manual-en/function.fbsql-insert-id.html
    • /usr/share/doc/php-manual-en/function.fbsql-list-dbs.html
    • /usr/share/doc/php-manual-en/function.fbsql-list-fields.html
    • /usr/share/doc/php-manual-en/function.fbsql-list-tables.html
    • /usr/share/doc/php-manual-en/function.fbsql-next-result.html
    • /usr/share/doc/php-manual-en/function.fbsql-num-fields.html
    • /usr/share/doc/php-manual-en/function.fbsql-num-rows.html
    • /usr/share/doc/php-manual-en/function.fbsql-password.html
    • /usr/share/doc/php-manual-en/function.fbsql-pconnect.html
    • /usr/share/doc/php-manual-en/function.fbsql-query.html
    • /usr/share/doc/php-manual-en/function.fbsql-read-blob.html
    • /usr/share/doc/php-manual-en/function.fbsql-read-clob.html
    • /usr/share/doc/php-manual-en/function.fbsql-result.html
    • /usr/share/doc/php-manual-en/function.fbsql-rollback.html
    • /usr/share/doc/php-manual-en/function.fbsql-rows-fetched.html
    • /usr/share/doc/php-manual-en/function.fbsql-select-db.html
    • /usr/share/doc/php-manual-en/function.fbsql-set-characterset.html
    • /usr/share/doc/php-manual-en/function.fbsql-set-lob-mode.html
    • /usr/share/doc/php-manual-en/function.fbsql-set-password.html
    • /usr/share/doc/php-manual-en/function.fbsql-set-transaction.html
    • /usr/share/doc/php-manual-en/function.fbsql-start-db.html
    • /usr/share/doc/php-manual-en/function.fbsql-stop-db.html
    • /usr/share/doc/php-manual-en/function.fbsql-table-name.html
    • /usr/share/doc/php-manual-en/function.fbsql-tablename.html
    • /usr/share/doc/php-manual-en/function.fbsql-username.html
    • /usr/share/doc/php-manual-en/function.fbsql-warnings.html
    • /usr/share/doc/php-manual-en/function.fclose.html
    • /usr/share/doc/php-manual-en/function.fdf-add-doc-javascript.html
    • /usr/share/doc/php-manual-en/function.fdf-add-template.html
    • /usr/share/doc/php-manual-en/function.fdf-close.html
    • /usr/share/doc/php-manual-en/function.fdf-create.html
    • /usr/share/doc/php-manual-en/function.fdf-enum-values.html
    • /usr/share/doc/php-manual-en/function.fdf-errno.html
    • /usr/share/doc/php-manual-en/function.fdf-error.html
    • /usr/share/doc/php-manual-en/function.fdf-get-ap.html
    • /usr/share/doc/php-manual-en/function.fdf-get-attachment.html
    • /usr/share/doc/php-manual-en/function.fdf-get-encoding.html
    • /usr/share/doc/php-manual-en/function.fdf-get-file.html
    • /usr/share/doc/php-manual-en/function.fdf-get-flags.html
    • /usr/share/doc/php-manual-en/function.fdf-get-opt.html
    • /usr/share/doc/php-manual-en/function.fdf-get-status.html
    • /usr/share/doc/php-manual-en/function.fdf-get-value.html
    • /usr/share/doc/php-manual-en/function.fdf-get-version.html
    • /usr/share/doc/php-manual-en/function.fdf-header.html
    • /usr/share/doc/php-manual-en/function.fdf-next-field-name.html
    • /usr/share/doc/php-manual-en/function.fdf-open-string.html
    • /usr/share/doc/php-manual-en/function.fdf-open.html
    • /usr/share/doc/php-manual-en/function.fdf-remove-item.html
    • /usr/share/doc/php-manual-en/function.fdf-save-string.html
    • /usr/share/doc/php-manual-en/function.fdf-save.html
    • /usr/share/doc/php-manual-en/function.fdf-set-ap.html
    • /usr/share/doc/php-manual-en/function.fdf-set-encoding.html
    • /usr/share/doc/php-manual-en/function.fdf-set-file.html
    • /usr/share/doc/php-manual-en/function.fdf-set-flags.html
    • /usr/share/doc/php-manual-en/function.fdf-set-javascript-action.html
    • /usr/share/doc/php-manual-en/function.fdf-set-on-import-javascript.html
    • /usr/share/doc/php-manual-en/function.fdf-set-opt.html
    • /usr/share/doc/php-manual-en/function.fdf-set-status.html
    • /usr/share/doc/php-manual-en/function.fdf-set-submit-form-action.html
    • /usr/share/doc/php-manual-en/function.fdf-set-target-frame.html
    • /usr/share/doc/php-manual-en/function.fdf-set-value.html
    • /usr/share/doc/php-manual-en/function.fdf-set-version.html
    • /usr/share/doc/php-manual-en/function.feof.html
    • /usr/share/doc/php-manual-en/function.fflush.html
    • /usr/share/doc/php-manual-en/function.fgetc.html
    • /usr/share/doc/php-manual-en/function.fgetcsv.html
    • /usr/share/doc/php-manual-en/function.fgets.html
    • /usr/share/doc/php-manual-en/function.fgetss.html
    • /usr/share/doc/php-manual-en/function.file-exists.html
    • /usr/share/doc/php-manual-en/function.file-get-contents.html
    • /usr/share/doc/php-manual-en/function.file-put-contents.html
    • /usr/share/doc/php-manual-en/function.file.html
    • /usr/share/doc/php-manual-en/function.fileatime.html
    • /usr/share/doc/php-manual-en/function.filectime.html
    • /usr/share/doc/php-manual-en/function.filegroup.html
    • /usr/share/doc/php-manual-en/function.fileinode.html
    • /usr/share/doc/php-manual-en/function.filemtime.html
    • /usr/share/doc/php-manual-en/function.fileowner.html
    • /usr/share/doc/php-manual-en/function.fileperms.html
    • /usr/share/doc/php-manual-en/function.filepro-fieldcount.html
    • /usr/share/doc/php-manual-en/function.filepro-fieldname.html
    • /usr/share/doc/php-manual-en/function.filepro-fieldtype.html
    • /usr/share/doc/php-manual-en/function.filepro-fieldwidth.html
    • /usr/share/doc/php-manual-en/function.filepro-retrieve.html
    • /usr/share/doc/php-manual-en/function.filepro-rowcount.html
    • /usr/share/doc/php-manual-en/function.filepro.html
    • /usr/share/doc/php-manual-en/function.filesize.html
    • /usr/share/doc/php-manual-en/function.filetype.html
    • /usr/share/doc/php-manual-en/function.filter-has-var.html
    • /usr/share/doc/php-manual-en/function.filter-id.html
    • /usr/share/doc/php-manual-en/function.filter-input-array.html
    • /usr/share/doc/php-manual-en/function.filter-input.html
    • /usr/share/doc/php-manual-en/function.filter-list.html
    • /usr/share/doc/php-manual-en/function.filter-var-array.html
    • /usr/share/doc/php-manual-en/function.filter-var.html
    • /usr/share/doc/php-manual-en/function.finfo-buffer.html
    • /usr/share/doc/php-manual-en/function.finfo-close.html
    • /usr/share/doc/php-manual-en/function.finfo-file.html
    • /usr/share/doc/php-manual-en/function.finfo-open.html
    • /usr/share/doc/php-manual-en/function.finfo-set-flags.html
    • /usr/share/doc/php-manual-en/function.floatval.html
    • /usr/share/doc/php-manual-en/function.flock.html
    • /usr/share/doc/php-manual-en/function.floor.html
    • /usr/share/doc/php-manual-en/function.flush.html
    • /usr/share/doc/php-manual-en/function.fmod.html
    • /usr/share/doc/php-manual-en/function.fnmatch.html
    • /usr/share/doc/php-manual-en/function.fopen.html
    • /usr/share/doc/php-manual-en/function.forward-static-call-array.html
    • /usr/share/doc/php-manual-en/function.forward-static-call.html
    • /usr/share/doc/php-manual-en/function.fpassthru.html
    • /usr/share/doc/php-manual-en/function.fprintf.html
    • /usr/share/doc/php-manual-en/function.fputcsv.html
    • /usr/share/doc/php-manual-en/function.fputs.html
    • /usr/share/doc/php-manual-en/function.fread.html
    • /usr/share/doc/php-manual-en/function.frenchtojd.html
    • /usr/share/doc/php-manual-en/function.fribidi-log2vis.html
    • /usr/share/doc/php-manual-en/function.fscanf.html
    • /usr/share/doc/php-manual-en/function.fseek.html
    • /usr/share/doc/php-manual-en/function.fsockopen.html
    • /usr/share/doc/php-manual-en/function.fstat.html
    • /usr/share/doc/php-manual-en/function.ftell.html
    • /usr/share/doc/php-manual-en/function.ftok.html
    • /usr/share/doc/php-manual-en/function.ftp-alloc.html
    • /usr/share/doc/php-manual-en/function.ftp-cdup.html
    • /usr/share/doc/php-manual-en/function.ftp-chdir.html
    • /usr/share/doc/php-manual-en/function.ftp-chmod.html
    • /usr/share/doc/php-manual-en/function.ftp-close.html
    • /usr/share/doc/php-manual-en/function.ftp-connect.html
    • /usr/share/doc/php-manual-en/function.ftp-delete.html
    • /usr/share/doc/php-manual-en/function.ftp-exec.html
    • /usr/share/doc/php-manual-en/function.ftp-fget.html
    • /usr/share/doc/php-manual-en/function.ftp-fput.html
    • /usr/share/doc/php-manual-en/function.ftp-get-option.html
    • /usr/share/doc/php-manual-en/function.ftp-get.html
    • /usr/share/doc/php-manual-en/function.ftp-login.html
    • /usr/share/doc/php-manual-en/function.ftp-mdtm.html
    • /usr/share/doc/php-manual-en/function.ftp-mkdir.html
    • /usr/share/doc/php-manual-en/function.ftp-nb-continue.html
    • /usr/share/doc/php-manual-en/function.ftp-nb-fget.html
    • /usr/share/doc/php-manual-en/function.ftp-nb-fput.html
    • /usr/share/doc/php-manual-en/function.ftp-nb-get.html
    • /usr/share/doc/php-manual-en/function.ftp-nb-put.html
    • /usr/share/doc/php-manual-en/function.ftp-nlist.html
    • /usr/share/doc/php-manual-en/function.ftp-pasv.html
    • /usr/share/doc/php-manual-en/function.ftp-put.html
    • /usr/share/doc/php-manual-en/function.ftp-pwd.html
    • /usr/share/doc/php-manual-en/function.ftp-quit.html
    • /usr/share/doc/php-manual-en/function.ftp-raw.html
    • /usr/share/doc/php-manual-en/function.ftp-rawlist.html
    • /usr/share/doc/php-manual-en/function.ftp-rename.html
    • /usr/share/doc/php-manual-en/function.ftp-rmdir.html
    • /usr/share/doc/php-manual-en/function.ftp-set-option.html
    • /usr/share/doc/php-manual-en/function.ftp-site.html
    • /usr/share/doc/php-manual-en/function.ftp-size.html
    • /usr/share/doc/php-manual-en/function.ftp-ssl-connect.html
    • /usr/share/doc/php-manual-en/function.ftp-systype.html
    • /usr/share/doc/php-manual-en/function.ftruncate.html
    • /usr/share/doc/php-manual-en/function.func-get-arg.html
    • /usr/share/doc/php-manual-en/function.func-get-args.html
    • /usr/share/doc/php-manual-en/function.func-name.html
    • /usr/share/doc/php-manual-en/function.func-num-args.html
    • /usr/share/doc/php-manual-en/function.function-exists.html
    • /usr/share/doc/php-manual-en/function.fwrite.html
    • /usr/share/doc/php-manual-en/function.gc-collect-cycles.html
    • /usr/share/doc/php-manual-en/function.gc-disable.html
    • /usr/share/doc/php-manual-en/function.gc-enable.html
    • /usr/share/doc/php-manual-en/function.gc-enabled.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.geoip-continent-code-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-country-code-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-country-code3-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-country-name-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-database-info.html
    • /usr/share/doc/php-manual-en/function.geoip-db-avail.html
    • /usr/share/doc/php-manual-en/function.geoip-db-filename.html
    • /usr/share/doc/php-manual-en/function.geoip-db-get-all-info.html
    • /usr/share/doc/php-manual-en/function.geoip-id-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-isp-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-org-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-record-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-region-by-name.html
    • /usr/share/doc/php-manual-en/function.geoip-region-name-by-code.html
    • /usr/share/doc/php-manual-en/function.geoip-time-zone-by-country-and-region.html
    • /usr/share/doc/php-manual-en/function.get-browser.html
    • /usr/share/doc/php-manual-en/function.get-called-class.html
    • /usr/share/doc/php-manual-en/function.get-cfg-var.html
    • /usr/share/doc/php-manual-en/function.get-class-methods.html
    • /usr/share/doc/php-manual-en/function.get-class-vars.html
    • /usr/share/doc/php-manual-en/function.get-class.html
    • /usr/share/doc/php-manual-en/function.get-current-user.html
    • /usr/share/doc/php-manual-en/function.get-declared-classes.html
    • /usr/share/doc/php-manual-en/function.get-declared-interfaces.html
    • /usr/share/doc/php-manual-en/function.get-declared-traits.html
    • /usr/share/doc/php-manual-en/function.get-defined-constants.html
    • /usr/share/doc/php-manual-en/function.get-defined-functions.html
    • /usr/share/doc/php-manual-en/function.get-defined-vars.html
    • /usr/share/doc/php-manual-en/function.get-extension-funcs.html
    • /usr/share/doc/php-manual-en/function.get-headers.html
    • /usr/share/doc/php-manual-en/function.get-html-translation-table.html
    • /usr/share/doc/php-manual-en/function.get-include-path.html
    • /usr/share/doc/php-manual-en/function.get-included-files.html
    • /usr/share/doc/php-manual-en/function.get-loaded-extensions.html
    • /usr/share/doc/php-manual-en/function.get-magic-quotes-gpc.html
    • /usr/share/doc/php-manual-en/function.get-magic-quotes-runtime.html
    • /usr/share/doc/php-manual-en/function.get-meta-tags.html
    • /usr/share/doc/php-manual-en/function.get-object-vars.html
    • /usr/share/doc/php-manual-en/function.get-parent-class.html
    • /usr/share/doc/php-manual-en/function.get-required-files.html
    • /usr/share/doc/php-manual-en/function.get-resource-type.html
    • /usr/share/doc/php-manual-en/function.getallheaders.html
    • /usr/share/doc/php-manual-en/function.getcwd.html
    • /usr/share/doc/php-manual-en/function.getdate.html
    • /usr/share/doc/php-manual-en/function.getenv.html
    • /usr/share/doc/php-manual-en/function.gethostbyaddr.html
    • /usr/share/doc/php-manual-en/function.gethostbyname.html
    • /usr/share/doc/php-manual-en/function.gethostbynamel.html
    • /usr/share/doc/php-manual-en/function.gethostname.html
    • /usr/share/doc/php-manual-en/function.getimagesize.html
    • /usr/share/doc/php-manual-en/function.getimagesizefromstring.html
    • /usr/share/doc/php-manual-en/function.getlastmod.html
    • /usr/share/doc/php-manual-en/function.getmxrr.html
    • /usr/share/doc/php-manual-en/function.getmygid.html
    • /usr/share/doc/php-manual-en/function.getmyinode.html
    • /usr/share/doc/php-manual-en/function.getmypid.html
    • /usr/share/doc/php-manual-en/function.getmyuid.html
    • /usr/share/doc/php-manual-en/function.getopt.html
    • /usr/share/doc/php-manual-en/function.getprotobyname.html
    • /usr/share/doc/php-manual-en/function.getprotobynumber.html
    • /usr/share/doc/php-manual-en/function.getrandmax.html
    • /usr/share/doc/php-manual-en/function.getrusage.html
    • /usr/share/doc/php-manual-en/function.getservbyname.html
    • /usr/share/doc/php-manual-en/function.getservbyport.html
    • /usr/share/doc/php-manual-en/function.gettext.html
    • /usr/share/doc/php-manual-en/function.gettimeofday.html
    • /usr/share/doc/php-manual-en/function.gettype.html
    • /usr/share/doc/php-manual-en/function.glob.html
    • /usr/share/doc/php-manual-en/function.gmdate.html
    • /usr/share/doc/php-manual-en/function.gmmktime.html
    • /usr/share/doc/php-manual-en/function.gmp-abs.html
    • /usr/share/doc/php-manual-en/function.gmp-add.html
    • /usr/share/doc/php-manual-en/function.gmp-and.html
    • /usr/share/doc/php-manual-en/function.gmp-clrbit.html
    • /usr/share/doc/php-manual-en/function.gmp-cmp.html
    • /usr/share/doc/php-manual-en/function.gmp-com.html
    • /usr/share/doc/php-manual-en/function.gmp-div-q.html
    • /usr/share/doc/php-manual-en/function.gmp-div-qr.html
    • /usr/share/doc/php-manual-en/function.gmp-div-r.html
    • /usr/share/doc/php-manual-en/function.gmp-div.html
    • /usr/share/doc/php-manual-en/function.gmp-divexact.html
    • /usr/share/doc/php-manual-en/function.gmp-fact.html
    • /usr/share/doc/php-manual-en/function.gmp-gcd.html
    • /usr/share/doc/php-manual-en/function.gmp-gcdext.html
    • /usr/share/doc/php-manual-en/function.gmp-hamdist.html
    • /usr/share/doc/php-manual-en/function.gmp-init.html
    • /usr/share/doc/php-manual-en/function.gmp-intval.html
    • /usr/share/doc/php-manual-en/function.gmp-invert.html
    • /usr/share/doc/php-manual-en/function.gmp-jacobi.html
    • /usr/share/doc/php-manual-en/function.gmp-legendre.html
    • /usr/share/doc/php-manual-en/function.gmp-mod.html
    • /usr/share/doc/php-manual-en/function.gmp-mul.html
    • /usr/share/doc/php-manual-en/function.gmp-neg.html
    • /usr/share/doc/php-manual-en/function.gmp-nextprime.html
    • /usr/share/doc/php-manual-en/function.gmp-or.html
    • /usr/share/doc/php-manual-en/function.gmp-perfect-square.html
    • /usr/share/doc/php-manual-en/function.gmp-popcount.html
    • /usr/share/doc/php-manual-en/function.gmp-pow.html
    • /usr/share/doc/php-manual-en/function.gmp-powm.html
    • /usr/share/doc/php-manual-en/function.gmp-prob-prime.html
    • /usr/share/doc/php-manual-en/function.gmp-random.html
    • /usr/share/doc/php-manual-en/function.gmp-scan0.html
    • /usr/share/doc/php-manual-en/function.gmp-scan1.html
    • /usr/share/doc/php-manual-en/function.gmp-setbit.html
    • /usr/share/doc/php-manual-en/function.gmp-sign.html
    • /usr/share/doc/php-manual-en/function.gmp-sqrt.html
    • /usr/share/doc/php-manual-en/function.gmp-sqrtrem.html
    • /usr/share/doc/php-manual-en/function.gmp-strval.html
    • /usr/share/doc/php-manual-en/function.gmp-sub.html
    • /usr/share/doc/php-manual-en/function.gmp-testbit.html
    • /usr/share/doc/php-manual-en/function.gmp-xor.html
    • /usr/share/doc/php-manual-en/function.gmstrftime.html
    • /usr/share/doc/php-manual-en/function.gnupg-adddecryptkey.html
    • /usr/share/doc/php-manual-en/function.gnupg-addencryptkey.html
    • /usr/share/doc/php-manual-en/function.gnupg-addsignkey.html
    • /usr/share/doc/php-manual-en/function.gnupg-cleardecryptkeys.html
    • /usr/share/doc/php-manual-en/function.gnupg-clearencryptkeys.html
    • /usr/share/doc/php-manual-en/function.gnupg-clearsignkeys.html
    • /usr/share/doc/php-manual-en/function.gnupg-decrypt.html
    • /usr/share/doc/php-manual-en/function.gnupg-decryptverify.html
    • /usr/share/doc/php-manual-en/function.gnupg-encrypt.html
    • /usr/share/doc/php-manual-en/function.gnupg-encryptsign.html
    • /usr/share/doc/php-manual-en/function.gnupg-export.html
    • /usr/share/doc/php-manual-en/function.gnupg-geterror.html
    • /usr/share/doc/php-manual-en/function.gnupg-getprotocol.html
    • /usr/share/doc/php-manual-en/function.gnupg-import.html
    • /usr/share/doc/php-manual-en/function.gnupg-init.html
    • /usr/share/doc/php-manual-en/function.gnupg-keyinfo.html
    • /usr/share/doc/php-manual-en/function.gnupg-setarmor.html
    • /usr/share/doc/php-manual-en/function.gnupg-seterrormode.html
    • /usr/share/doc/php-manual-en/function.gnupg-setsignmode.html
    • /usr/share/doc/php-manual-en/function.gnupg-sign.html
    • /usr/share/doc/php-manual-en/function.gnupg-verify.html
    • /usr/share/doc/php-manual-en/function.gopher-parsedir.html
    • /usr/share/doc/php-manual-en/function.grapheme-extract.html
    • /usr/share/doc/php-manual-en/function.grapheme-stripos.html
    • /usr/share/doc/php-manual-en/function.grapheme-stristr.html
    • /usr/share/doc/php-manual-en/function.grapheme-strlen.html
    • /usr/share/doc/php-manual-en/function.grapheme-strpos.html
    • /usr/share/doc/php-manual-en/function.grapheme-strripos.html
    • /usr/share/doc/php-manual-en/function.grapheme-strrpos.html
    • /usr/share/doc/php-manual-en/function.grapheme-strstr.html
    • /usr/share/doc/php-manual-en/function.grapheme-substr.html
    • /usr/share/doc/php-manual-en/function.gregoriantojd.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-get-host-ip.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-get-port.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-get-subscription-timeout.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-host-path.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-new.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-set-subscription-timeout.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-timeout-add.html
    • /usr/share/doc/php-manual-en/function.gupnp-context-unhost-path.html
    • /usr/share/doc/php-manual-en/function.gupnp-control-point-browse-start.html
    • /usr/share/doc/php-manual-en/function.gupnp-control-point-browse-stop.html
    • /usr/share/doc/php-manual-en/function.gupnp-control-point-callback-set.html
    • /usr/share/doc/php-manual-en/function.gupnp-control-point-new.html
    • /usr/share/doc/php-manual-en/function.gupnp-device-action-callback-set.html
    • /usr/share/doc/php-manual-en/function.gupnp-device-info-get-service.html
    • /usr/share/doc/php-manual-en/function.gupnp-device-info-get.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-get-available.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-get-relative-location.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-new.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-set-available.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-start.html
    • /usr/share/doc/php-manual-en/function.gupnp-root-device-stop.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-action-get.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-action-return-error.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-action-return.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-action-set.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-freeze-notify.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-info-get-introspection.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-info-get.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-introspection-get-state-variable.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-notify.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-action-get.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-action-set.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-add-notify.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-callback-set.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-get-subscribed.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-remove-notify.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-proxy-set-subscribed.html
    • /usr/share/doc/php-manual-en/function.gupnp-service-thaw-notify.html
    • /usr/share/doc/php-manual-en/function.gzclose.html
    • /usr/share/doc/php-manual-en/function.gzcompress.html
    • /usr/share/doc/php-manual-en/function.gzdecode.html
    • /usr/share/doc/php-manual-en/function.gzdeflate.html
    • /usr/share/doc/php-manual-en/function.gzencode.html
    • /usr/share/doc/php-manual-en/function.gzeof.html
    • /usr/share/doc/php-manual-en/function.gzfile.html
    • /usr/share/doc/php-manual-en/function.gzgetc.html
    • /usr/share/doc/php-manual-en/function.gzgets.html
    • /usr/share/doc/php-manual-en/function.gzgetss.html
    • /usr/share/doc/php-manual-en/function.gzinflate.html
    • /usr/share/doc/php-manual-en/function.gzopen.html
    • /usr/share/doc/php-manual-en/function.gzpassthru.html
    • /usr/share/doc/php-manual-en/function.gzputs.html
    • /usr/share/doc/php-manual-en/function.gzread.html
    • /usr/share/doc/php-manual-en/function.gzrewind.html
    • /usr/share/doc/php-manual-en/function.gzseek.html
    • /usr/share/doc/php-manual-en/function.gztell.html
    • /usr/share/doc/php-manual-en/function.gzuncompress.html
    • /usr/share/doc/php-manual-en/function.gzwrite.html
    • /usr/share/doc/php-manual-en/function.halt-compiler.html
    • /usr/share/doc/php-manual-en/function.hash-algos.html
    • /usr/share/doc/php-manual-en/function.hash-copy.html
    • /usr/share/doc/php-manual-en/function.hash-file.html
    • /usr/share/doc/php-manual-en/function.hash-final.html
    • /usr/share/doc/php-manual-en/function.hash-hmac-file.html
    • /usr/share/doc/php-manual-en/function.hash-hmac.html
    • /usr/share/doc/php-manual-en/function.hash-init.html
    • /usr/share/doc/php-manual-en/function.hash-pbkdf2.html
    • /usr/share/doc/php-manual-en/function.hash-update-file.html
    • /usr/share/doc/php-manual-en/function.hash-update-stream.html
    • /usr/share/doc/php-manual-en/function.hash-update.html
    • /usr/share/doc/php-manual-en/function.hash.html
    • /usr/share/doc/php-manual-en/function.header-register-callback.html
    • /usr/share/doc/php-manual-en/function.header-remove.html
    • /usr/share/doc/php-manual-en/function.header.html
    • /usr/share/doc/php-manual-en/function.headers-list.html
    • /usr/share/doc/php-manual-en/function.headers-sent.html
    • /usr/share/doc/php-manual-en/function.hebrev.html
    • /usr/share/doc/php-manual-en/function.hebrevc.html
    • /usr/share/doc/php-manual-en/function.hex2bin.html
    • /usr/share/doc/php-manual-en/function.hexdec.html
    • /usr/share/doc/php-manual-en/function.highlight-file.html
    • /usr/share/doc/php-manual-en/function.highlight-string.html
    • /usr/share/doc/php-manual-en/function.html-entity-decode.html
    • /usr/share/doc/php-manual-en/function.htmlentities.html
    • /usr/share/doc/php-manual-en/function.htmlspecialchars-decode.html
    • /usr/share/doc/php-manual-en/function.htmlspecialchars.html
    • /usr/share/doc/php-manual-en/function.http-build-cookie.html
    • /usr/share/doc/php-manual-en/function.http-build-query.html
    • /usr/share/doc/php-manual-en/function.http-build-str.html
    • /usr/share/doc/php-manual-en/function.http-build-url.html
    • /usr/share/doc/php-manual-en/function.http-cache-etag.html
    • /usr/share/doc/php-manual-en/function.http-cache-last-modified.html
    • /usr/share/doc/php-manual-en/function.http-chunked-decode.html
    • /usr/share/doc/php-manual-en/function.http-date.html
    • /usr/share/doc/php-manual-en/function.http-deflate.html
    • /usr/share/doc/php-manual-en/function.http-get-request-body-stream.html
    • /usr/share/doc/php-manual-en/function.http-get-request-body.html
    • /usr/share/doc/php-manual-en/function.http-get-request-headers.html
    • /usr/share/doc/php-manual-en/function.http-get.html
    • /usr/share/doc/php-manual-en/function.http-head.html
    • /usr/share/doc/php-manual-en/function.http-inflate.html
    • /usr/share/doc/php-manual-en/function.http-match-etag.html
    • /usr/share/doc/php-manual-en/function.http-match-modified.html
    • /usr/share/doc/php-manual-en/function.http-match-request-header.html
    • /usr/share/doc/php-manual-en/function.http-negotiate-charset.html
    • /usr/share/doc/php-manual-en/function.http-negotiate-content-type.html
    • /usr/share/doc/php-manual-en/function.http-negotiate-language.html
    • /usr/share/doc/php-manual-en/function.http-parse-cookie.html
    • /usr/share/doc/php-manual-en/function.http-parse-headers.html
    • /usr/share/doc/php-manual-en/function.http-parse-message.html
    • /usr/share/doc/php-manual-en/function.http-parse-params.html
    • /usr/share/doc/php-manual-en/function.http-persistent-handles-clean.html
    • /usr/share/doc/php-manual-en/function.http-persistent-handles-count.html
    • /usr/share/doc/php-manual-en/function.http-persistent-handles-ident.html
    • /usr/share/doc/php-manual-en/function.http-post-data.html
    • /usr/share/doc/php-manual-en/function.http-post-fields.html
    • /usr/share/doc/php-manual-en/function.http-put-data.html
    • /usr/share/doc/php-manual-en/function.http-put-file.html
    • /usr/share/doc/php-manual-en/function.http-put-stream.html
    • /usr/share/doc/php-manual-en/function.http-redirect.html
    • /usr/share/doc/php-manual-en/function.http-request-body-encode.html
    • /usr/share/doc/php-manual-en/function.http-request-method-exists.html
    • /usr/share/doc/php-manual-en/function.http-request-method-name.html
    • /usr/share/doc/php-manual-en/function.http-request-method-register.html
    • /usr/share/doc/php-manual-en/function.http-request-method-unregister.html
    • /usr/share/doc/php-manual-en/function.http-request.html
    • /usr/share/doc/php-manual-en/function.http-response-code.html
    • /usr/share/doc/php-manual-en/function.http-send-content-disposition.html
    • /usr/share/doc/php-manual-en/function.http-send-content-type.html
    • /usr/share/doc/php-manual-en/function.http-send-data.html
    • /usr/share/doc/php-manual-en/function.http-send-file.html
    • /usr/share/doc/php-manual-en/function.http-send-last-modified.html
    • /usr/share/doc/php-manual-en/function.http-send-status.html
    • /usr/share/doc/php-manual-en/function.http-send-stream.html
    • /usr/share/doc/php-manual-en/function.http-support.html
    • /usr/share/doc/php-manual-en/function.http-throttle.html
    • /usr/share/doc/php-manual-en/function.hw-array2objrec.html
    • /usr/share/doc/php-manual-en/function.hw-changeobject.html
    • /usr/share/doc/php-manual-en/function.hw-children.html
    • /usr/share/doc/php-manual-en/function.hw-childrenobj.html
    • /usr/share/doc/php-manual-en/function.hw-close.html
    • /usr/share/doc/php-manual-en/function.hw-connect.html
    • /usr/share/doc/php-manual-en/function.hw-connection-info.html
    • /usr/share/doc/php-manual-en/function.hw-cp.html
    • /usr/share/doc/php-manual-en/function.hw-deleteobject.html
    • /usr/share/doc/php-manual-en/function.hw-docbyanchor.html
    • /usr/share/doc/php-manual-en/function.hw-docbyanchorobj.html
    • /usr/share/doc/php-manual-en/function.hw-document-attributes.html
    • /usr/share/doc/php-manual-en/function.hw-document-bodytag.html
    • /usr/share/doc/php-manual-en/function.hw-document-content.html
    • /usr/share/doc/php-manual-en/function.hw-document-setcontent.html
    • /usr/share/doc/php-manual-en/function.hw-document-size.html
    • /usr/share/doc/php-manual-en/function.hw-dummy.html
    • /usr/share/doc/php-manual-en/function.hw-edittext.html
    • /usr/share/doc/php-manual-en/function.hw-error.html
    • /usr/share/doc/php-manual-en/function.hw-errormsg.html
    • /usr/share/doc/php-manual-en/function.hw-free-document.html
    • /usr/share/doc/php-manual-en/function.hw-getanchors.html
    • /usr/share/doc/php-manual-en/function.hw-getanchorsobj.html
    • /usr/share/doc/php-manual-en/function.hw-getandlock.html
    • /usr/share/doc/php-manual-en/function.hw-getchildcoll.html
    • /usr/share/doc/php-manual-en/function.hw-getchildcollobj.html
    • /usr/share/doc/php-manual-en/function.hw-getchilddoccoll.html
    • /usr/share/doc/php-manual-en/function.hw-getchilddoccollobj.html
    • /usr/share/doc/php-manual-en/function.hw-getobject.html
    • /usr/share/doc/php-manual-en/function.hw-getobjectbyquery.html
    • /usr/share/doc/php-manual-en/function.hw-getobjectbyquerycoll.html
    • /usr/share/doc/php-manual-en/function.hw-getobjectbyquerycollobj.html
    • /usr/share/doc/php-manual-en/function.hw-getobjectbyqueryobj.html
    • /usr/share/doc/php-manual-en/function.hw-getparents.html
    • /usr/share/doc/php-manual-en/function.hw-getparentsobj.html
    • /usr/share/doc/php-manual-en/function.hw-getrellink.html
    • /usr/share/doc/php-manual-en/function.hw-getremote.html
    • /usr/share/doc/php-manual-en/function.hw-getremotechildren.html
    • /usr/share/doc/php-manual-en/function.hw-getsrcbydestobj.html
    • /usr/share/doc/php-manual-en/function.hw-gettext.html
    • /usr/share/doc/php-manual-en/function.hw-getusername.html
    • /usr/share/doc/php-manual-en/function.hw-identify.html
    • /usr/share/doc/php-manual-en/function.hw-incollections.html
    • /usr/share/doc/php-manual-en/function.hw-info.html
    • /usr/share/doc/php-manual-en/function.hw-inscoll.html
    • /usr/share/doc/php-manual-en/function.hw-insdoc.html
    • /usr/share/doc/php-manual-en/function.hw-insertanchors.html
    • /usr/share/doc/php-manual-en/function.hw-insertdocument.html
    • /usr/share/doc/php-manual-en/function.hw-insertobject.html
    • /usr/share/doc/php-manual-en/function.hw-mapid.html
    • /usr/share/doc/php-manual-en/function.hw-modifyobject.html
    • /usr/share/doc/php-manual-en/function.hw-mv.html
    • /usr/share/doc/php-manual-en/function.hw-new-document.html
    • /usr/share/doc/php-manual-en/function.hw-objrec2array.html
    • /usr/share/doc/php-manual-en/function.hw-output-document.html
    • /usr/share/doc/php-manual-en/function.hw-pconnect.html
    • /usr/share/doc/php-manual-en/function.hw-pipedocument.html
    • /usr/share/doc/php-manual-en/function.hw-root.html
    • /usr/share/doc/php-manual-en/function.hw-setlinkroot.html
    • /usr/share/doc/php-manual-en/function.hw-stat.html
    • /usr/share/doc/php-manual-en/function.hw-unlock.html
    • /usr/share/doc/php-manual-en/function.hw-who.html
    • /usr/share/doc/php-manual-en/function.hwapi-attribute-new.html
    • /usr/share/doc/php-manual-en/function.hwapi-content-new.html
    • /usr/share/doc/php-manual-en/function.hwapi-hgcsp.html
    • /usr/share/doc/php-manual-en/function.hwapi-object-new.html
    • /usr/share/doc/php-manual-en/function.hypot.html
    • /usr/share/doc/php-manual-en/function.ibase-add-user.html
    • /usr/share/doc/php-manual-en/function.ibase-affected-rows.html
    • /usr/share/doc/php-manual-en/function.ibase-backup.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-add.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-cancel.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-close.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-create.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-echo.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-get.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-import.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-info.html
    • /usr/share/doc/php-manual-en/function.ibase-blob-open.html
    • /usr/share/doc/php-manual-en/function.ibase-close.html
    • /usr/share/doc/php-manual-en/function.ibase-commit-ret.html
    • /usr/share/doc/php-manual-en/function.ibase-commit.html
    • /usr/share/doc/php-manual-en/function.ibase-connect.html
    • /usr/share/doc/php-manual-en/function.ibase-db-info.html
    • /usr/share/doc/php-manual-en/function.ibase-delete-user.html
    • /usr/share/doc/php-manual-en/function.ibase-drop-db.html
    • /usr/share/doc/php-manual-en/function.ibase-errcode.html
    • /usr/share/doc/php-manual-en/function.ibase-errmsg.html
    • /usr/share/doc/php-manual-en/function.ibase-execute.html
    • /usr/share/doc/php-manual-en/function.ibase-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.ibase-fetch-object.html
    • /usr/share/doc/php-manual-en/function.ibase-fetch-row.html
    • /usr/share/doc/php-manual-en/function.ibase-field-info.html
    • /usr/share/doc/php-manual-en/function.ibase-free-event-handler.html
    • /usr/share/doc/php-manual-en/function.ibase-free-query.html
    • /usr/share/doc/php-manual-en/function.ibase-free-result.html
    • /usr/share/doc/php-manual-en/function.ibase-gen-id.html
    • /usr/share/doc/php-manual-en/function.ibase-maintain-db.html
    • /usr/share/doc/php-manual-en/function.ibase-modify-user.html
    • /usr/share/doc/php-manual-en/function.ibase-name-result.html
    • /usr/share/doc/php-manual-en/function.ibase-num-fields.html
    • /usr/share/doc/php-manual-en/function.ibase-num-params.html
    • /usr/share/doc/php-manual-en/function.ibase-param-info.html
    • /usr/share/doc/php-manual-en/function.ibase-pconnect.html
    • /usr/share/doc/php-manual-en/function.ibase-prepare.html
    • /usr/share/doc/php-manual-en/function.ibase-query.html
    • /usr/share/doc/php-manual-en/function.ibase-restore.html
    • /usr/share/doc/php-manual-en/function.ibase-rollback-ret.html
    • /usr/share/doc/php-manual-en/function.ibase-rollback.html
    • /usr/share/doc/php-manual-en/function.ibase-server-info.html
    • /usr/share/doc/php-manual-en/function.ibase-service-attach.html
    • /usr/share/doc/php-manual-en/function.ibase-service-detach.html
    • /usr/share/doc/php-manual-en/function.ibase-set-event-handler.html
    • /usr/share/doc/php-manual-en/function.ibase-trans.html
    • /usr/share/doc/php-manual-en/function.ibase-wait-event.html
    • /usr/share/doc/php-manual-en/function.iconv-get-encoding.html
    • /usr/share/doc/php-manual-en/function.iconv-mime-decode-headers.html
    • /usr/share/doc/php-manual-en/function.iconv-mime-decode.html
    • /usr/share/doc/php-manual-en/function.iconv-mime-encode.html
    • /usr/share/doc/php-manual-en/function.iconv-set-encoding.html
    • /usr/share/doc/php-manual-en/function.iconv-strlen.html
    • /usr/share/doc/php-manual-en/function.iconv-strpos.html
    • /usr/share/doc/php-manual-en/function.iconv-strrpos.html
    • /usr/share/doc/php-manual-en/function.iconv-substr.html
    • /usr/share/doc/php-manual-en/function.iconv.html
    • /usr/share/doc/php-manual-en/function.id3-get-frame-long-name.html
    • /usr/share/doc/php-manual-en/function.id3-get-frame-short-name.html
    • /usr/share/doc/php-manual-en/function.id3-get-genre-id.html
    • /usr/share/doc/php-manual-en/function.id3-get-genre-list.html
    • /usr/share/doc/php-manual-en/function.id3-get-genre-name.html
    • /usr/share/doc/php-manual-en/function.id3-get-tag.html
    • /usr/share/doc/php-manual-en/function.id3-get-version.html
    • /usr/share/doc/php-manual-en/function.id3-remove-tag.html
    • /usr/share/doc/php-manual-en/function.id3-set-tag.html
    • /usr/share/doc/php-manual-en/function.idate.html
    • /usr/share/doc/php-manual-en/function.idn-to-ascii.html
    • /usr/share/doc/php-manual-en/function.idn-to-unicode.html
    • /usr/share/doc/php-manual-en/function.idn-to-utf8.html
    • /usr/share/doc/php-manual-en/function.ifx-affected-rows.html
    • /usr/share/doc/php-manual-en/function.ifx-blobinfile-mode.html
    • /usr/share/doc/php-manual-en/function.ifx-byteasvarchar.html
    • /usr/share/doc/php-manual-en/function.ifx-close.html
    • /usr/share/doc/php-manual-en/function.ifx-connect.html
    • /usr/share/doc/php-manual-en/function.ifx-copy-blob.html
    • /usr/share/doc/php-manual-en/function.ifx-create-blob.html
    • /usr/share/doc/php-manual-en/function.ifx-create-char.html
    • /usr/share/doc/php-manual-en/function.ifx-do.html
    • /usr/share/doc/php-manual-en/function.ifx-error.html
    • /usr/share/doc/php-manual-en/function.ifx-errormsg.html
    • /usr/share/doc/php-manual-en/function.ifx-fetch-row.html
    • /usr/share/doc/php-manual-en/function.ifx-fieldproperties.html
    • /usr/share/doc/php-manual-en/function.ifx-fieldtypes.html
    • /usr/share/doc/php-manual-en/function.ifx-free-blob.html
    • /usr/share/doc/php-manual-en/function.ifx-free-char.html
    • /usr/share/doc/php-manual-en/function.ifx-free-result.html
    • /usr/share/doc/php-manual-en/function.ifx-get-blob.html
    • /usr/share/doc/php-manual-en/function.ifx-get-char.html
    • /usr/share/doc/php-manual-en/function.ifx-getsqlca.html
    • /usr/share/doc/php-manual-en/function.ifx-htmltbl-result.html
    • /usr/share/doc/php-manual-en/function.ifx-nullformat.html
    • /usr/share/doc/php-manual-en/function.ifx-num-fields.html
    • /usr/share/doc/php-manual-en/function.ifx-num-rows.html
    • /usr/share/doc/php-manual-en/function.ifx-pconnect.html
    • /usr/share/doc/php-manual-en/function.ifx-prepare.html
    • /usr/share/doc/php-manual-en/function.ifx-query.html
    • /usr/share/doc/php-manual-en/function.ifx-textasvarchar.html
    • /usr/share/doc/php-manual-en/function.ifx-update-blob.html
    • /usr/share/doc/php-manual-en/function.ifx-update-char.html
    • /usr/share/doc/php-manual-en/function.ifxus-close-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-create-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-free-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-open-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-read-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-seek-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-tell-slob.html
    • /usr/share/doc/php-manual-en/function.ifxus-write-slob.html
    • /usr/share/doc/php-manual-en/function.ignore-user-abort.html
    • /usr/share/doc/php-manual-en/function.iis-add-server.html
    • /usr/share/doc/php-manual-en/function.iis-get-dir-security.html
    • /usr/share/doc/php-manual-en/function.iis-get-script-map.html
    • /usr/share/doc/php-manual-en/function.iis-get-server-by-comment.html
    • /usr/share/doc/php-manual-en/function.iis-get-server-by-path.html
    • /usr/share/doc/php-manual-en/function.iis-get-server-rights.html
    • /usr/share/doc/php-manual-en/function.iis-get-service-state.html
    • /usr/share/doc/php-manual-en/function.iis-remove-server.html
    • /usr/share/doc/php-manual-en/function.iis-set-app-settings.html
    • /usr/share/doc/php-manual-en/function.iis-set-dir-security.html
    • /usr/share/doc/php-manual-en/function.iis-set-script-map.html
    • /usr/share/doc/php-manual-en/function.iis-set-server-rights.html
    • /usr/share/doc/php-manual-en/function.iis-start-server.html
    • /usr/share/doc/php-manual-en/function.iis-start-service.html
    • /usr/share/doc/php-manual-en/function.iis-stop-server.html
    • /usr/share/doc/php-manual-en/function.iis-stop-service.html
    • /usr/share/doc/php-manual-en/function.image-type-to-extension.html
    • /usr/share/doc/php-manual-en/function.image-type-to-mime-type.html
    • /usr/share/doc/php-manual-en/function.image2wbmp.html
    • /usr/share/doc/php-manual-en/function.imageaffine.html
    • /usr/share/doc/php-manual-en/function.imageaffinematrixconcat.html
    • /usr/share/doc/php-manual-en/function.imageaffinematrixget.html
    • /usr/share/doc/php-manual-en/function.imagealphablending.html
    • /usr/share/doc/php-manual-en/function.imageantialias.html
    • /usr/share/doc/php-manual-en/function.imagearc.html
    • /usr/share/doc/php-manual-en/function.imagechar.html
    • /usr/share/doc/php-manual-en/function.imagecharup.html
    • /usr/share/doc/php-manual-en/function.imagecolorallocate.html
    • /usr/share/doc/php-manual-en/function.imagecolorallocatealpha.html
    • /usr/share/doc/php-manual-en/function.imagecolorat.html
    • /usr/share/doc/php-manual-en/function.imagecolorclosest.html
    • /usr/share/doc/php-manual-en/function.imagecolorclosestalpha.html
    • /usr/share/doc/php-manual-en/function.imagecolorclosesthwb.html
    • /usr/share/doc/php-manual-en/function.imagecolordeallocate.html
    • /usr/share/doc/php-manual-en/function.imagecolorexact.html
    • /usr/share/doc/php-manual-en/function.imagecolorexactalpha.html
    • /usr/share/doc/php-manual-en/function.imagecolormatch.html
    • /usr/share/doc/php-manual-en/function.imagecolorresolve.html
    • /usr/share/doc/php-manual-en/function.imagecolorresolvealpha.html
    • /usr/share/doc/php-manual-en/function.imagecolorset.html
    • /usr/share/doc/php-manual-en/function.imagecolorsforindex.html
    • /usr/share/doc/php-manual-en/function.imagecolorstotal.html
    • /usr/share/doc/php-manual-en/function.imagecolortransparent.html
    • /usr/share/doc/php-manual-en/function.imageconvolution.html
    • /usr/share/doc/php-manual-en/function.imagecopy.html
    • /usr/share/doc/php-manual-en/function.imagecopymerge.html
    • /usr/share/doc/php-manual-en/function.imagecopymergegray.html
    • /usr/share/doc/php-manual-en/function.imagecopyresampled.html
    • /usr/share/doc/php-manual-en/function.imagecopyresized.html
    • /usr/share/doc/php-manual-en/function.imagecreate.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromgd.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromgd2.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromgd2part.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromgif.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromjpeg.html
    • /usr/share/doc/php-manual-en/function.imagecreatefrompng.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromstring.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromwbmp.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromwebp.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromxbm.html
    • /usr/share/doc/php-manual-en/function.imagecreatefromxpm.html
    • /usr/share/doc/php-manual-en/function.imagecreatetruecolor.html
    • /usr/share/doc/php-manual-en/function.imagecrop.html
    • /usr/share/doc/php-manual-en/function.imagecropauto.html
    • /usr/share/doc/php-manual-en/function.imagedashedline.html
    • /usr/share/doc/php-manual-en/function.imagedestroy.html
    • /usr/share/doc/php-manual-en/function.imageellipse.html
    • /usr/share/doc/php-manual-en/function.imagefill.html
    • /usr/share/doc/php-manual-en/function.imagefilledarc.html
    • /usr/share/doc/php-manual-en/function.imagefilledellipse.html
    • /usr/share/doc/php-manual-en/function.imagefilledpolygon.html
    • /usr/share/doc/php-manual-en/function.imagefilledrectangle.html
    • /usr/share/doc/php-manual-en/function.imagefilltoborder.html
    • /usr/share/doc/php-manual-en/function.imagefilter.html
    • /usr/share/doc/php-manual-en/function.imageflip.html
    • /usr/share/doc/php-manual-en/function.imagefontheight.html
    • /usr/share/doc/php-manual-en/function.imagefontwidth.html
    • /usr/share/doc/php-manual-en/function.imageftbbox.html
    • /usr/share/doc/php-manual-en/function.imagefttext.html
    • /usr/share/doc/php-manual-en/function.imagegammacorrect.html
    • /usr/share/doc/php-manual-en/function.imagegd.html
    • /usr/share/doc/php-manual-en/function.imagegd2.html
    • /usr/share/doc/php-manual-en/function.imagegif.html
    • /usr/share/doc/php-manual-en/function.imagegrabscreen.html
    • /usr/share/doc/php-manual-en/function.imagegrabwindow.html
    • /usr/share/doc/php-manual-en/function.imageinterlace.html
    • /usr/share/doc/php-manual-en/function.imageistruecolor.html
    • /usr/share/doc/php-manual-en/function.imagejpeg.html
    • /usr/share/doc/php-manual-en/function.imagelayereffect.html
    • /usr/share/doc/php-manual-en/function.imageline.html
    • /usr/share/doc/php-manual-en/function.imageloadfont.html
    • /usr/share/doc/php-manual-en/function.imagepalettecopy.html
    • /usr/share/doc/php-manual-en/function.imagepalettetotruecolor.html
    • /usr/share/doc/php-manual-en/function.imagepng.html
    • /usr/share/doc/php-manual-en/function.imagepolygon.html
    • /usr/share/doc/php-manual-en/function.imagepsbbox.html
    • /usr/share/doc/php-manual-en/function.imagepsencodefont.html
    • /usr/share/doc/php-manual-en/function.imagepsextendfont.html
    • /usr/share/doc/php-manual-en/function.imagepsfreefont.html
    • /usr/share/doc/php-manual-en/function.imagepsloadfont.html
    • /usr/share/doc/php-manual-en/function.imagepsslantfont.html
    • /usr/share/doc/php-manual-en/function.imagepstext.html
    • /usr/share/doc/php-manual-en/function.imagerectangle.html
    • /usr/share/doc/php-manual-en/function.imagerotate.html
    • /usr/share/doc/php-manual-en/function.imagesavealpha.html
    • /usr/share/doc/php-manual-en/function.imagescale.html
    • /usr/share/doc/php-manual-en/function.imagesetbrush.html
    • /usr/share/doc/php-manual-en/function.imagesetinterpolation.html
    • /usr/share/doc/php-manual-en/function.imagesetpixel.html
    • /usr/share/doc/php-manual-en/function.imagesetstyle.html
    • /usr/share/doc/php-manual-en/function.imagesetthickness.html
    • /usr/share/doc/php-manual-en/function.imagesettile.html
    • /usr/share/doc/php-manual-en/function.imagestring.html
    • /usr/share/doc/php-manual-en/function.imagestringup.html
    • /usr/share/doc/php-manual-en/function.imagesx.html
    • /usr/share/doc/php-manual-en/function.imagesy.html
    • /usr/share/doc/php-manual-en/function.imagetruecolortopalette.html
    • /usr/share/doc/php-manual-en/function.imagettfbbox.html
    • /usr/share/doc/php-manual-en/function.imagettftext.html
    • /usr/share/doc/php-manual-en/function.imagetypes.html
    • /usr/share/doc/php-manual-en/function.imagewbmp.html
    • /usr/share/doc/php-manual-en/function.imagewebp.html
    • /usr/share/doc/php-manual-en/function.imagexbm.html
    • /usr/share/doc/php-manual-en/function.imap-8bit.html
    • /usr/share/doc/php-manual-en/function.imap-alerts.html
    • /usr/share/doc/php-manual-en/function.imap-append.html
    • /usr/share/doc/php-manual-en/function.imap-base64.html
    • /usr/share/doc/php-manual-en/function.imap-binary.html
    • /usr/share/doc/php-manual-en/function.imap-body.html
    • /usr/share/doc/php-manual-en/function.imap-bodystruct.html
    • /usr/share/doc/php-manual-en/function.imap-check.html
    • /usr/share/doc/php-manual-en/function.imap-clearflag-full.html
    • /usr/share/doc/php-manual-en/function.imap-close.html
    • /usr/share/doc/php-manual-en/function.imap-create.html
    • /usr/share/doc/php-manual-en/function.imap-createmailbox.html
    • /usr/share/doc/php-manual-en/function.imap-delete.html
    • /usr/share/doc/php-manual-en/function.imap-deletemailbox.html
    • /usr/share/doc/php-manual-en/function.imap-errors.html
    • /usr/share/doc/php-manual-en/function.imap-expunge.html
    • /usr/share/doc/php-manual-en/function.imap-fetch-overview.html
    • /usr/share/doc/php-manual-en/function.imap-fetchbody.html
    • /usr/share/doc/php-manual-en/function.imap-fetchheader.html
    • /usr/share/doc/php-manual-en/function.imap-fetchmime.html
    • /usr/share/doc/php-manual-en/function.imap-fetchstructure.html
    • /usr/share/doc/php-manual-en/function.imap-fetchtext.html
    • /usr/share/doc/php-manual-en/function.imap-gc.html
    • /usr/share/doc/php-manual-en/function.imap-get-quota.html
    • /usr/share/doc/php-manual-en/function.imap-get-quotaroot.html
    • /usr/share/doc/php-manual-en/function.imap-getacl.html
    • /usr/share/doc/php-manual-en/function.imap-getmailboxes.html
    • /usr/share/doc/php-manual-en/function.imap-getsubscribed.html
    • /usr/share/doc/php-manual-en/function.imap-header.html
    • /usr/share/doc/php-manual-en/function.imap-headerinfo.html
    • /usr/share/doc/php-manual-en/function.imap-headers.html
    • /usr/share/doc/php-manual-en/function.imap-last-error.html
    • /usr/share/doc/php-manual-en/function.imap-list.html
    • /usr/share/doc/php-manual-en/function.imap-listmailbox.html
    • /usr/share/doc/php-manual-en/function.imap-listscan.html
    • /usr/share/doc/php-manual-en/function.imap-listsubscribed.html
    • /usr/share/doc/php-manual-en/function.imap-lsub.html
    • /usr/share/doc/php-manual-en/function.imap-mail-compose.html
    • /usr/share/doc/php-manual-en/function.imap-mail-copy.html
    • /usr/share/doc/php-manual-en/function.imap-mail-move.html
    • /usr/share/doc/php-manual-en/function.imap-mail.html
    • /usr/share/doc/php-manual-en/function.imap-mailboxmsginfo.html
    • /usr/share/doc/php-manual-en/function.imap-mime-header-decode.html
    • /usr/share/doc/php-manual-en/function.imap-msgno.html
    • /usr/share/doc/php-manual-en/function.imap-num-msg.html
    • /usr/share/doc/php-manual-en/function.imap-num-recent.html
    • /usr/share/doc/php-manual-en/function.imap-open.html
    • /usr/share/doc/php-manual-en/function.imap-ping.html
    • /usr/share/doc/php-manual-en/function.imap-qprint.html
    • /usr/share/doc/php-manual-en/function.imap-rename.html
    • /usr/share/doc/php-manual-en/function.imap-renamemailbox.html
    • /usr/share/doc/php-manual-en/function.imap-reopen.html
    • /usr/share/doc/php-manual-en/function.imap-rfc822-parse-adrlist.html
    • /usr/share/doc/php-manual-en/function.imap-rfc822-parse-headers.html
    • /usr/share/doc/php-manual-en/function.imap-rfc822-write-address.html
    • /usr/share/doc/php-manual-en/function.imap-savebody.html
    • /usr/share/doc/php-manual-en/function.imap-scan.html
    • /usr/share/doc/php-manual-en/function.imap-scanmailbox.html
    • /usr/share/doc/php-manual-en/function.imap-search.html
    • /usr/share/doc/php-manual-en/function.imap-set-quota.html
    • /usr/share/doc/php-manual-en/function.imap-setacl.html
    • /usr/share/doc/php-manual-en/function.imap-setflag-full.html
    • /usr/share/doc/php-manual-en/function.imap-sort.html
    • /usr/share/doc/php-manual-en/function.imap-status.html
    • /usr/share/doc/php-manual-en/function.imap-subscribe.html
    • /usr/share/doc/php-manual-en/function.imap-thread.html
    • /usr/share/doc/php-manual-en/function.imap-timeout.html
    • /usr/share/doc/php-manual-en/function.imap-uid.html
    • /usr/share/doc/php-manual-en/function.imap-undelete.html
    • /usr/share/doc/php-manual-en/function.imap-unsubscribe.html
    • /usr/share/doc/php-manual-en/function.imap-utf7-decode.html
    • /usr/share/doc/php-manual-en/function.imap-utf7-encode.html
    • /usr/share/doc/php-manual-en/function.imap-utf8.html
    • /usr/share/doc/php-manual-en/function.implode.html
    • /usr/share/doc/php-manual-en/function.import-request-variables.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.include-once.html
    • /usr/share/doc/php-manual-en/function.include.html
    • /usr/share/doc/php-manual-en/function.inclued-get-data.html
    • /usr/share/doc/php-manual-en/function.inet-ntop.html
    • /usr/share/doc/php-manual-en/function.inet-pton.html
    • /usr/share/doc/php-manual-en/function.ingres-autocommit-state.html
    • /usr/share/doc/php-manual-en/function.ingres-autocommit.html
    • /usr/share/doc/php-manual-en/function.ingres-charset.html
    • /usr/share/doc/php-manual-en/function.ingres-close.html
    • /usr/share/doc/php-manual-en/function.ingres-commit.html
    • /usr/share/doc/php-manual-en/function.ingres-connect.html
    • /usr/share/doc/php-manual-en/function.ingres-cursor.html
    • /usr/share/doc/php-manual-en/function.ingres-errno.html
    • /usr/share/doc/php-manual-en/function.ingres-error.html
    • /usr/share/doc/php-manual-en/function.ingres-errsqlstate.html
    • /usr/share/doc/php-manual-en/function.ingres-escape-string.html
    • /usr/share/doc/php-manual-en/function.ingres-execute.html
    • /usr/share/doc/php-manual-en/function.ingres-fetch-array.html
    • /usr/share/doc/php-manual-en/function.ingres-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.ingres-fetch-object.html
    • /usr/share/doc/php-manual-en/function.ingres-fetch-proc-return.html
    • /usr/share/doc/php-manual-en/function.ingres-fetch-row.html
    • /usr/share/doc/php-manual-en/function.ingres-field-length.html
    • /usr/share/doc/php-manual-en/function.ingres-field-name.html
    • /usr/share/doc/php-manual-en/function.ingres-field-nullable.html
    • /usr/share/doc/php-manual-en/function.ingres-field-precision.html
    • /usr/share/doc/php-manual-en/function.ingres-field-scale.html
    • /usr/share/doc/php-manual-en/function.ingres-field-type.html
    • /usr/share/doc/php-manual-en/function.ingres-free-result.html
    • /usr/share/doc/php-manual-en/function.ingres-next-error.html
    • /usr/share/doc/php-manual-en/function.ingres-num-fields.html
    • /usr/share/doc/php-manual-en/function.ingres-num-rows.html
    • /usr/share/doc/php-manual-en/function.ingres-pconnect.html
    • /usr/share/doc/php-manual-en/function.ingres-prepare.html
    • /usr/share/doc/php-manual-en/function.ingres-query.html
    • /usr/share/doc/php-manual-en/function.ingres-result-seek.html
    • /usr/share/doc/php-manual-en/function.ingres-rollback.html
    • /usr/share/doc/php-manual-en/function.ingres-set-environment.html
    • /usr/share/doc/php-manual-en/function.ingres-unbuffered-query.html
    • /usr/share/doc/php-manual-en/function.ini-alter.html
    • /usr/share/doc/php-manual-en/function.ini-get-all.html
    • /usr/share/doc/php-manual-en/function.ini-get.html
    • /usr/share/doc/php-manual-en/function.ini-restore.html
    • /usr/share/doc/php-manual-en/function.ini-set.html
    • /usr/share/doc/php-manual-en/function.inotify-add-watch.html
    • /usr/share/doc/php-manual-en/function.inotify-init.html
    • /usr/share/doc/php-manual-en/function.inotify-queue-len.html
    • /usr/share/doc/php-manual-en/function.inotify-read.html
    • /usr/share/doc/php-manual-en/function.inotify-rm-watch.html
    • /usr/share/doc/php-manual-en/function.interface-exists.html
    • /usr/share/doc/php-manual-en/function.intl-error-name.html
    • /usr/share/doc/php-manual-en/function.intl-get-error-code.html
    • /usr/share/doc/php-manual-en/function.intl-get-error-message.html
    • /usr/share/doc/php-manual-en/function.intl-is-failure.html
    • /usr/share/doc/php-manual-en/function.intval.html
    • /usr/share/doc/php-manual-en/function.ip2long.html
    • /usr/share/doc/php-manual-en/function.iptcembed.html
    • /usr/share/doc/php-manual-en/function.iptcparse.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.isset.html
    • /usr/share/doc/php-manual-en/function.iterator-apply.html
    • /usr/share/doc/php-manual-en/function.iterator-count.html
    • /usr/share/doc/php-manual-en/function.iterator-to-array.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.jddayofweek.html
    • /usr/share/doc/php-manual-en/function.jdmonthname.html
    • /usr/share/doc/php-manual-en/function.jdtofrench.html
    • /usr/share/doc/php-manual-en/function.jdtogregorian.html
    • /usr/share/doc/php-manual-en/function.jdtojewish.html
    • /usr/share/doc/php-manual-en/function.jdtojulian.html
    • /usr/share/doc/php-manual-en/function.jdtounix.html
    • /usr/share/doc/php-manual-en/function.jewishtojd.html
    • /usr/share/doc/php-manual-en/function.join.html
    • /usr/share/doc/php-manual-en/function.jpeg2wbmp.html
    • /usr/share/doc/php-manual-en/function.json-decode.html
    • /usr/share/doc/php-manual-en/function.json-encode.html
    • /usr/share/doc/php-manual-en/function.json-last-error-msg.html
    • /usr/share/doc/php-manual-en/function.json-last-error.html
    • /usr/share/doc/php-manual-en/function.judy-type.html
    • /usr/share/doc/php-manual-en/function.judy-version.html
    • /usr/share/doc/php-manual-en/function.juliantojd.html
    • /usr/share/doc/php-manual-en/function.kadm5-chpass-principal.html
    • /usr/share/doc/php-manual-en/function.kadm5-create-principal.html
    • /usr/share/doc/php-manual-en/function.kadm5-delete-principal.html
    • /usr/share/doc/php-manual-en/function.kadm5-destroy.html
    • /usr/share/doc/php-manual-en/function.kadm5-flush.html
    • /usr/share/doc/php-manual-en/function.kadm5-get-policies.html
    • /usr/share/doc/php-manual-en/function.kadm5-get-principal.html
    • /usr/share/doc/php-manual-en/function.kadm5-get-principals.html
    • /usr/share/doc/php-manual-en/function.kadm5-init-with-password.html
    • /usr/share/doc/php-manual-en/function.kadm5-modify-principal.html
    • /usr/share/doc/php-manual-en/function.key-exists.html
    • /usr/share/doc/php-manual-en/function.key.html
    • /usr/share/doc/php-manual-en/function.krsort.html
    • /usr/share/doc/php-manual-en/function.ksort.html
    • /usr/share/doc/php-manual-en/function.lcfirst.html
    • /usr/share/doc/php-manual-en/function.lcg-value.html
    • /usr/share/doc/php-manual-en/function.lchgrp.html
    • /usr/share/doc/php-manual-en/function.lchown.html
    • /usr/share/doc/php-manual-en/function.ldap-8859-to-t61.html
    • /usr/share/doc/php-manual-en/function.ldap-add.html
    • /usr/share/doc/php-manual-en/function.ldap-bind.html
    • /usr/share/doc/php-manual-en/function.ldap-close.html
    • /usr/share/doc/php-manual-en/function.ldap-compare.html
    • /usr/share/doc/php-manual-en/function.ldap-connect.html
    • /usr/share/doc/php-manual-en/function.ldap-control-paged-result-response.html
    • /usr/share/doc/php-manual-en/function.ldap-control-paged-result.html
    • /usr/share/doc/php-manual-en/function.ldap-count-entries.html
    • /usr/share/doc/php-manual-en/function.ldap-delete.html
    • /usr/share/doc/php-manual-en/function.ldap-dn2ufn.html
    • /usr/share/doc/php-manual-en/function.ldap-err2str.html
    • /usr/share/doc/php-manual-en/function.ldap-errno.html
    • /usr/share/doc/php-manual-en/function.ldap-error.html
    • /usr/share/doc/php-manual-en/function.ldap-explode-dn.html
    • /usr/share/doc/php-manual-en/function.ldap-first-attribute.html
    • /usr/share/doc/php-manual-en/function.ldap-first-entry.html
    • /usr/share/doc/php-manual-en/function.ldap-first-reference.html
    • /usr/share/doc/php-manual-en/function.ldap-free-result.html
    • /usr/share/doc/php-manual-en/function.ldap-get-attributes.html
    • /usr/share/doc/php-manual-en/function.ldap-get-dn.html
    • /usr/share/doc/php-manual-en/function.ldap-get-entries.html
    • /usr/share/doc/php-manual-en/function.ldap-get-option.html
    • /usr/share/doc/php-manual-en/function.ldap-get-values-len.html
    • /usr/share/doc/php-manual-en/function.ldap-get-values.html
    • /usr/share/doc/php-manual-en/function.ldap-list.html
    • /usr/share/doc/php-manual-en/function.ldap-mod-add.html
    • /usr/share/doc/php-manual-en/function.ldap-mod-del.html
    • /usr/share/doc/php-manual-en/function.ldap-mod-replace.html
    • /usr/share/doc/php-manual-en/function.ldap-modify.html
    • /usr/share/doc/php-manual-en/function.ldap-next-attribute.html
    • /usr/share/doc/php-manual-en/function.ldap-next-entry.html
    • /usr/share/doc/php-manual-en/function.ldap-next-reference.html
    • /usr/share/doc/php-manual-en/function.ldap-parse-reference.html
    • /usr/share/doc/php-manual-en/function.ldap-parse-result.html
    • /usr/share/doc/php-manual-en/function.ldap-read.html
    • /usr/share/doc/php-manual-en/function.ldap-rename.html
    • /usr/share/doc/php-manual-en/function.ldap-sasl-bind.html
    • /usr/share/doc/php-manual-en/function.ldap-search.html
    • /usr/share/doc/php-manual-en/function.ldap-set-option.html
    • /usr/share/doc/php-manual-en/function.ldap-set-rebind-proc.html
    • /usr/share/doc/php-manual-en/function.ldap-sort.html
    • /usr/share/doc/php-manual-en/function.ldap-start-tls.html
    • /usr/share/doc/php-manual-en/function.ldap-t61-to-8859.html
    • /usr/share/doc/php-manual-en/function.ldap-unbind.html
    • /usr/share/doc/php-manual-en/function.levenshtein.html
    • /usr/share/doc/php-manual-en/function.libxml-clear-errors.html
    • /usr/share/doc/php-manual-en/function.libxml-disable-entity-loader.html
    • /usr/share/doc/php-manual-en/function.libxml-get-errors.html
    • /usr/share/doc/php-manual-en/function.libxml-get-last-error.html
    • /usr/share/doc/php-manual-en/function.libxml-set-external-entity-loader.html
    • /usr/share/doc/php-manual-en/function.libxml-set-streams-context.html
    • /usr/share/doc/php-manual-en/function.libxml-use-internal-errors.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.linkinfo.html
    • /usr/share/doc/php-manual-en/function.list.html
    • /usr/share/doc/php-manual-en/function.localeconv.html
    • /usr/share/doc/php-manual-en/function.localtime.html
    • /usr/share/doc/php-manual-en/function.log.html
    • /usr/share/doc/php-manual-en/function.log10.html
    • /usr/share/doc/php-manual-en/function.log1p.html
    • /usr/share/doc/php-manual-en/function.long2ip.html
    • /usr/share/doc/php-manual-en/function.lstat.html
    • /usr/share/doc/php-manual-en/function.ltrim.html
    • /usr/share/doc/php-manual-en/function.lzf-compress.html
    • /usr/share/doc/php-manual-en/function.lzf-decompress.html
    • /usr/share/doc/php-manual-en/function.lzf-optimized-for.html
    • /usr/share/doc/php-manual-en/function.m-checkstatus.html
    • /usr/share/doc/php-manual-en/function.m-completeauthorizations.html
    • /usr/share/doc/php-manual-en/function.m-connect.html
    • /usr/share/doc/php-manual-en/function.m-connectionerror.html
    • /usr/share/doc/php-manual-en/function.m-deletetrans.html
    • /usr/share/doc/php-manual-en/function.m-destroyconn.html
    • /usr/share/doc/php-manual-en/function.m-destroyengine.html
    • /usr/share/doc/php-manual-en/function.m-getcell.html
    • /usr/share/doc/php-manual-en/function.m-getcellbynum.html
    • /usr/share/doc/php-manual-en/function.m-getcommadelimited.html
    • /usr/share/doc/php-manual-en/function.m-getheader.html
    • /usr/share/doc/php-manual-en/function.m-initconn.html
    • /usr/share/doc/php-manual-en/function.m-initengine.html
    • /usr/share/doc/php-manual-en/function.m-iscommadelimited.html
    • /usr/share/doc/php-manual-en/function.m-maxconntimeout.html
    • /usr/share/doc/php-manual-en/function.m-monitor.html
    • /usr/share/doc/php-manual-en/function.m-numcolumns.html
    • /usr/share/doc/php-manual-en/function.m-numrows.html
    • /usr/share/doc/php-manual-en/function.m-parsecommadelimited.html
    • /usr/share/doc/php-manual-en/function.m-responsekeys.html
    • /usr/share/doc/php-manual-en/function.m-responseparam.html
    • /usr/share/doc/php-manual-en/function.m-returnstatus.html
    • /usr/share/doc/php-manual-en/function.m-setblocking.html
    • /usr/share/doc/php-manual-en/function.m-setdropfile.html
    • /usr/share/doc/php-manual-en/function.m-setip.html
    • /usr/share/doc/php-manual-en/function.m-setssl-cafile.html
    • /usr/share/doc/php-manual-en/function.m-setssl-files.html
    • /usr/share/doc/php-manual-en/function.m-setssl.html
    • /usr/share/doc/php-manual-en/function.m-settimeout.html
    • /usr/share/doc/php-manual-en/function.m-sslcert-gen-hash.html
    • /usr/share/doc/php-manual-en/function.m-transactionssent.html
    • /usr/share/doc/php-manual-en/function.m-transinqueue.html
    • /usr/share/doc/php-manual-en/function.m-transkeyval.html
    • /usr/share/doc/php-manual-en/function.m-transnew.html
    • /usr/share/doc/php-manual-en/function.m-transsend.html
    • /usr/share/doc/php-manual-en/function.m-uwait.html
    • /usr/share/doc/php-manual-en/function.m-validateidentifier.html
    • /usr/share/doc/php-manual-en/function.m-verifyconnection.html
    • /usr/share/doc/php-manual-en/function.m-verifysslcert.html
    • /usr/share/doc/php-manual-en/function.magic-quotes-runtime.html
    • /usr/share/doc/php-manual-en/function.mail.html
    • /usr/share/doc/php-manual-en/function.mailparse-determine-best-xfer-encoding.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-create.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-extract-part-file.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-extract-part.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-extract-whole-part-file.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-free.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-get-part-data.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-get-part.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-get-structure.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-parse-file.html
    • /usr/share/doc/php-manual-en/function.mailparse-msg-parse.html
    • /usr/share/doc/php-manual-en/function.mailparse-rfc822-parse-addresses.html
    • /usr/share/doc/php-manual-en/function.mailparse-stream-encode.html
    • /usr/share/doc/php-manual-en/function.mailparse-uudecode-all.html
    • /usr/share/doc/php-manual-en/function.main.html
    • /usr/share/doc/php-manual-en/function.max.html
    • /usr/share/doc/php-manual-en/function.maxdb-affected-rows.html
    • /usr/share/doc/php-manual-en/function.maxdb-autocommit.html
    • /usr/share/doc/php-manual-en/function.maxdb-bind-param.html
    • /usr/share/doc/php-manual-en/function.maxdb-bind-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-change-user.html
    • /usr/share/doc/php-manual-en/function.maxdb-character-set-name.html
    • /usr/share/doc/php-manual-en/function.maxdb-client-encoding.html
    • /usr/share/doc/php-manual-en/function.maxdb-close-long-data.html
    • /usr/share/doc/php-manual-en/function.maxdb-close.html
    • /usr/share/doc/php-manual-en/function.maxdb-commit.html
    • /usr/share/doc/php-manual-en/function.maxdb-connect-errno.html
    • /usr/share/doc/php-manual-en/function.maxdb-connect-error.html
    • /usr/share/doc/php-manual-en/function.maxdb-connect.html
    • /usr/share/doc/php-manual-en/function.maxdb-data-seek.html
    • /usr/share/doc/php-manual-en/function.maxdb-debug.html
    • /usr/share/doc/php-manual-en/function.maxdb-disable-reads-from-master.html
    • /usr/share/doc/php-manual-en/function.maxdb-disable-rpl-parse.html
    • /usr/share/doc/php-manual-en/function.maxdb-dump-debug-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-embedded-connect.html
    • /usr/share/doc/php-manual-en/function.maxdb-enable-reads-from-master.html
    • /usr/share/doc/php-manual-en/function.maxdb-enable-rpl-parse.html
    • /usr/share/doc/php-manual-en/function.maxdb-errno.html
    • /usr/share/doc/php-manual-en/function.maxdb-error.html
    • /usr/share/doc/php-manual-en/function.maxdb-escape-string.html
    • /usr/share/doc/php-manual-en/function.maxdb-execute.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-array.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-field-direct.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-field.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-fields.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-lengths.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-object.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch-row.html
    • /usr/share/doc/php-manual-en/function.maxdb-fetch.html
    • /usr/share/doc/php-manual-en/function.maxdb-field-count.html
    • /usr/share/doc/php-manual-en/function.maxdb-field-seek.html
    • /usr/share/doc/php-manual-en/function.maxdb-field-tell.html
    • /usr/share/doc/php-manual-en/function.maxdb-free-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-client-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-client-version.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-host-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-metadata.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-proto-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-server-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-get-server-version.html
    • /usr/share/doc/php-manual-en/function.maxdb-info.html
    • /usr/share/doc/php-manual-en/function.maxdb-init.html
    • /usr/share/doc/php-manual-en/function.maxdb-insert-id.html
    • /usr/share/doc/php-manual-en/function.maxdb-kill.html
    • /usr/share/doc/php-manual-en/function.maxdb-master-query.html
    • /usr/share/doc/php-manual-en/function.maxdb-more-results.html
    • /usr/share/doc/php-manual-en/function.maxdb-multi-query.html
    • /usr/share/doc/php-manual-en/function.maxdb-next-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-num-fields.html
    • /usr/share/doc/php-manual-en/function.maxdb-num-rows.html
    • /usr/share/doc/php-manual-en/function.maxdb-options.html
    • /usr/share/doc/php-manual-en/function.maxdb-param-count.html
    • /usr/share/doc/php-manual-en/function.maxdb-ping.html
    • /usr/share/doc/php-manual-en/function.maxdb-prepare.html
    • /usr/share/doc/php-manual-en/function.maxdb-query.html
    • /usr/share/doc/php-manual-en/function.maxdb-real-connect.html
    • /usr/share/doc/php-manual-en/function.maxdb-real-escape-string.html
    • /usr/share/doc/php-manual-en/function.maxdb-real-query.html
    • /usr/share/doc/php-manual-en/function.maxdb-report.html
    • /usr/share/doc/php-manual-en/function.maxdb-rollback.html
    • /usr/share/doc/php-manual-en/function.maxdb-rpl-parse-enabled.html
    • /usr/share/doc/php-manual-en/function.maxdb-rpl-probe.html
    • /usr/share/doc/php-manual-en/function.maxdb-rpl-query-type.html
    • /usr/share/doc/php-manual-en/function.maxdb-select-db.html
    • /usr/share/doc/php-manual-en/function.maxdb-send-long-data.html
    • /usr/share/doc/php-manual-en/function.maxdb-send-query.html
    • /usr/share/doc/php-manual-en/function.maxdb-server-end.html
    • /usr/share/doc/php-manual-en/function.maxdb-server-init.html
    • /usr/share/doc/php-manual-en/function.maxdb-set-opt.html
    • /usr/share/doc/php-manual-en/function.maxdb-sqlstate.html
    • /usr/share/doc/php-manual-en/function.maxdb-ssl-set.html
    • /usr/share/doc/php-manual-en/function.maxdb-stat.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-affected-rows.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-bind-param.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-bind-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-close-long-data.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-close.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-data-seek.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-errno.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-error.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-execute.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-fetch.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-free-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-init.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-num-rows.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-param-count.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-prepare.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-reset.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-result-metadata.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-send-long-data.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-sqlstate.html
    • /usr/share/doc/php-manual-en/function.maxdb-stmt-store-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-store-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-thread-id.html
    • /usr/share/doc/php-manual-en/function.maxdb-thread-safe.html
    • /usr/share/doc/php-manual-en/function.maxdb-use-result.html
    • /usr/share/doc/php-manual-en/function.maxdb-warning-count.html
    • /usr/share/doc/php-manual-en/function.mb-check-encoding.html
    • /usr/share/doc/php-manual-en/function.mb-convert-case.html
    • /usr/share/doc/php-manual-en/function.mb-convert-encoding.html
    • /usr/share/doc/php-manual-en/function.mb-convert-kana.html
    • /usr/share/doc/php-manual-en/function.mb-convert-variables.html
    • /usr/share/doc/php-manual-en/function.mb-decode-mimeheader.html
    • /usr/share/doc/php-manual-en/function.mb-decode-numericentity.html
    • /usr/share/doc/php-manual-en/function.mb-detect-encoding.html
    • /usr/share/doc/php-manual-en/function.mb-detect-order.html
    • /usr/share/doc/php-manual-en/function.mb-encode-mimeheader.html
    • /usr/share/doc/php-manual-en/function.mb-encode-numericentity.html
    • /usr/share/doc/php-manual-en/function.mb-encoding-aliases.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-match.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-replace-callback.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-replace.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-getpos.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-getregs.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-init.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-pos.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-regs.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search-setpos.html
    • /usr/share/doc/php-manual-en/function.mb-ereg-search.html
    • /usr/share/doc/php-manual-en/function.mb-ereg.html
    • /usr/share/doc/php-manual-en/function.mb-eregi-replace.html
    • /usr/share/doc/php-manual-en/function.mb-eregi.html
    • /usr/share/doc/php-manual-en/function.mb-get-info.html
    • /usr/share/doc/php-manual-en/function.mb-http-input.html
    • /usr/share/doc/php-manual-en/function.mb-http-output.html
    • /usr/share/doc/php-manual-en/function.mb-internal-encoding.html
    • /usr/share/doc/php-manual-en/function.mb-language.html
    • /usr/share/doc/php-manual-en/function.mb-list-encodings.html
    • /usr/share/doc/php-manual-en/function.mb-output-handler.html
    • /usr/share/doc/php-manual-en/function.mb-parse-str.html
    • /usr/share/doc/php-manual-en/function.mb-preferred-mime-name.html
    • /usr/share/doc/php-manual-en/function.mb-regex-encoding.html
    • /usr/share/doc/php-manual-en/function.mb-regex-set-options.html
    • /usr/share/doc/php-manual-en/function.mb-send-mail.html
    • /usr/share/doc/php-manual-en/function.mb-split.html
    • /usr/share/doc/php-manual-en/function.mb-strcut.html
    • /usr/share/doc/php-manual-en/function.mb-strimwidth.html
    • /usr/share/doc/php-manual-en/function.mb-stripos.html
    • /usr/share/doc/php-manual-en/function.mb-stristr.html
    • /usr/share/doc/php-manual-en/function.mb-strlen.html
    • /usr/share/doc/php-manual-en/function.mb-strpos.html
    • /usr/share/doc/php-manual-en/function.mb-strrchr.html
    • /usr/share/doc/php-manual-en/function.mb-strrichr.html
    • /usr/share/doc/php-manual-en/function.mb-strripos.html
    • /usr/share/doc/php-manual-en/function.mb-strrpos.html
    • /usr/share/doc/php-manual-en/function.mb-strstr.html
    • /usr/share/doc/php-manual-en/function.mb-strtolower.html
    • /usr/share/doc/php-manual-en/function.mb-strtoupper.html
    • /usr/share/doc/php-manual-en/function.mb-strwidth.html
    • /usr/share/doc/php-manual-en/function.mb-substitute-character.html
    • /usr/share/doc/php-manual-en/function.mb-substr-count.html
    • /usr/share/doc/php-manual-en/function.mb-substr.html
    • /usr/share/doc/php-manual-en/function.mcrypt-cbc.html
    • /usr/share/doc/php-manual-en/function.mcrypt-cfb.html
    • /usr/share/doc/php-manual-en/function.mcrypt-create-iv.html
    • /usr/share/doc/php-manual-en/function.mcrypt-decrypt.html
    • /usr/share/doc/php-manual-en/function.mcrypt-ecb.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-algorithms-name.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-block-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-iv-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-key-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-modes-name.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-get-supported-key-sizes.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-is-block-algorithm-mode.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-is-block-algorithm.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-is-block-mode.html
    • /usr/share/doc/php-manual-en/function.mcrypt-enc-self-test.html
    • /usr/share/doc/php-manual-en/function.mcrypt-encrypt.html
    • /usr/share/doc/php-manual-en/function.mcrypt-generic-deinit.html
    • /usr/share/doc/php-manual-en/function.mcrypt-generic-end.html
    • /usr/share/doc/php-manual-en/function.mcrypt-generic-init.html
    • /usr/share/doc/php-manual-en/function.mcrypt-generic.html
    • /usr/share/doc/php-manual-en/function.mcrypt-get-block-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-get-cipher-name.html
    • /usr/share/doc/php-manual-en/function.mcrypt-get-iv-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-get-key-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-list-algorithms.html
    • /usr/share/doc/php-manual-en/function.mcrypt-list-modes.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-close.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-get-algo-block-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-get-algo-key-size.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-get-supported-key-sizes.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-is-block-algorithm-mode.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-is-block-algorithm.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-is-block-mode.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-open.html
    • /usr/share/doc/php-manual-en/function.mcrypt-module-self-test.html
    • /usr/share/doc/php-manual-en/function.mcrypt-ofb.html
    • /usr/share/doc/php-manual-en/function.md5-file.html
    • /usr/share/doc/php-manual-en/function.md5.html
    • /usr/share/doc/php-manual-en/function.mdecrypt-generic.html
    • /usr/share/doc/php-manual-en/function.memcache-debug.html
    • /usr/share/doc/php-manual-en/function.memory-get-peak-usage.html
    • /usr/share/doc/php-manual-en/function.memory-get-usage.html
    • /usr/share/doc/php-manual-en/function.metaphone.html
    • /usr/share/doc/php-manual-en/function.method-exists.html
    • /usr/share/doc/php-manual-en/function.mhash-count.html
    • /usr/share/doc/php-manual-en/function.mhash-get-block-size.html
    • /usr/share/doc/php-manual-en/function.mhash-get-hash-name.html
    • /usr/share/doc/php-manual-en/function.mhash-keygen-s2k.html
    • /usr/share/doc/php-manual-en/function.mhash.html
    • /usr/share/doc/php-manual-en/function.microtime.html
    • /usr/share/doc/php-manual-en/function.mime-content-type.html
    • /usr/share/doc/php-manual-en/function.min.html
    • /usr/share/doc/php-manual-en/function.ming-keypress.html
    • /usr/share/doc/php-manual-en/function.ming-setcubicthreshold.html
    • /usr/share/doc/php-manual-en/function.ming-setscale.html
    • /usr/share/doc/php-manual-en/function.ming-setswfcompression.html
    • /usr/share/doc/php-manual-en/function.ming-useconstants.html
    • /usr/share/doc/php-manual-en/function.ming-useswfversion.html
    • /usr/share/doc/php-manual-en/function.mkdir.html
    • /usr/share/doc/php-manual-en/function.mktime.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.move-uploaded-file.html
    • /usr/share/doc/php-manual-en/function.mqseries-back.html
    • /usr/share/doc/php-manual-en/function.mqseries-begin.html
    • /usr/share/doc/php-manual-en/function.mqseries-close.html
    • /usr/share/doc/php-manual-en/function.mqseries-cmit.html
    • /usr/share/doc/php-manual-en/function.mqseries-conn.html
    • /usr/share/doc/php-manual-en/function.mqseries-connx.html
    • /usr/share/doc/php-manual-en/function.mqseries-disc.html
    • /usr/share/doc/php-manual-en/function.mqseries-get.html
    • /usr/share/doc/php-manual-en/function.mqseries-inq.html
    • /usr/share/doc/php-manual-en/function.mqseries-open.html
    • /usr/share/doc/php-manual-en/function.mqseries-put.html
    • /usr/share/doc/php-manual-en/function.mqseries-put1.html
    • /usr/share/doc/php-manual-en/function.mqseries-set.html
    • /usr/share/doc/php-manual-en/function.mqseries-strerror.html
    • /usr/share/doc/php-manual-en/function.msession-connect.html
    • /usr/share/doc/php-manual-en/function.msession-count.html
    • /usr/share/doc/php-manual-en/function.msession-create.html
    • /usr/share/doc/php-manual-en/function.msession-destroy.html
    • /usr/share/doc/php-manual-en/function.msession-disconnect.html
    • /usr/share/doc/php-manual-en/function.msession-find.html
    • /usr/share/doc/php-manual-en/function.msession-get-array.html
    • /usr/share/doc/php-manual-en/function.msession-get-data.html
    • /usr/share/doc/php-manual-en/function.msession-get.html
    • /usr/share/doc/php-manual-en/function.msession-inc.html
    • /usr/share/doc/php-manual-en/function.msession-list.html
    • /usr/share/doc/php-manual-en/function.msession-listvar.html
    • /usr/share/doc/php-manual-en/function.msession-lock.html
    • /usr/share/doc/php-manual-en/function.msession-plugin.html
    • /usr/share/doc/php-manual-en/function.msession-randstr.html
    • /usr/share/doc/php-manual-en/function.msession-set-array.html
    • /usr/share/doc/php-manual-en/function.msession-set-data.html
    • /usr/share/doc/php-manual-en/function.msession-set.html
    • /usr/share/doc/php-manual-en/function.msession-timeout.html
    • /usr/share/doc/php-manual-en/function.msession-uniq.html
    • /usr/share/doc/php-manual-en/function.msession-unlock.html
    • /usr/share/doc/php-manual-en/function.msg-get-queue.html
    • /usr/share/doc/php-manual-en/function.msg-queue-exists.html
    • /usr/share/doc/php-manual-en/function.msg-receive.html
    • /usr/share/doc/php-manual-en/function.msg-remove-queue.html
    • /usr/share/doc/php-manual-en/function.msg-send.html
    • /usr/share/doc/php-manual-en/function.msg-set-queue.html
    • /usr/share/doc/php-manual-en/function.msg-stat-queue.html
    • /usr/share/doc/php-manual-en/function.msql-affected-rows.html
    • /usr/share/doc/php-manual-en/function.msql-close.html
    • /usr/share/doc/php-manual-en/function.msql-connect.html
    • /usr/share/doc/php-manual-en/function.msql-create-db.html
    • /usr/share/doc/php-manual-en/function.msql-createdb.html
    • /usr/share/doc/php-manual-en/function.msql-data-seek.html
    • /usr/share/doc/php-manual-en/function.msql-db-query.html
    • /usr/share/doc/php-manual-en/function.msql-dbname.html
    • /usr/share/doc/php-manual-en/function.msql-drop-db.html
    • /usr/share/doc/php-manual-en/function.msql-error.html
    • /usr/share/doc/php-manual-en/function.msql-fetch-array.html
    • /usr/share/doc/php-manual-en/function.msql-fetch-field.html
    • /usr/share/doc/php-manual-en/function.msql-fetch-object.html
    • /usr/share/doc/php-manual-en/function.msql-fetch-row.html
    • /usr/share/doc/php-manual-en/function.msql-field-flags.html
    • /usr/share/doc/php-manual-en/function.msql-field-len.html
    • /usr/share/doc/php-manual-en/function.msql-field-name.html
    • /usr/share/doc/php-manual-en/function.msql-field-seek.html
    • /usr/share/doc/php-manual-en/function.msql-field-table.html
    • /usr/share/doc/php-manual-en/function.msql-field-type.html
    • /usr/share/doc/php-manual-en/function.msql-fieldflags.html
    • /usr/share/doc/php-manual-en/function.msql-fieldlen.html
    • /usr/share/doc/php-manual-en/function.msql-fieldname.html
    • /usr/share/doc/php-manual-en/function.msql-fieldtable.html
    • /usr/share/doc/php-manual-en/function.msql-fieldtype.html
    • /usr/share/doc/php-manual-en/function.msql-free-result.html
    • /usr/share/doc/php-manual-en/function.msql-list-dbs.html
    • /usr/share/doc/php-manual-en/function.msql-list-fields.html
    • /usr/share/doc/php-manual-en/function.msql-list-tables.html
    • /usr/share/doc/php-manual-en/function.msql-num-fields.html
    • /usr/share/doc/php-manual-en/function.msql-num-rows.html
    • /usr/share/doc/php-manual-en/function.msql-numfields.html
    • /usr/share/doc/php-manual-en/function.msql-numrows.html
    • /usr/share/doc/php-manual-en/function.msql-pconnect.html
    • /usr/share/doc/php-manual-en/function.msql-query.html
    • /usr/share/doc/php-manual-en/function.msql-regcase.html
    • /usr/share/doc/php-manual-en/function.msql-result.html
    • /usr/share/doc/php-manual-en/function.msql-select-db.html
    • /usr/share/doc/php-manual-en/function.msql-tablename.html
    • /usr/share/doc/php-manual-en/function.msql.html
    • /usr/share/doc/php-manual-en/function.mssql-bind.html
    • /usr/share/doc/php-manual-en/function.mssql-close.html
    • /usr/share/doc/php-manual-en/function.mssql-connect.html
    • /usr/share/doc/php-manual-en/function.mssql-data-seek.html
    • /usr/share/doc/php-manual-en/function.mssql-execute.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-array.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-batch.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-field.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-object.html
    • /usr/share/doc/php-manual-en/function.mssql-fetch-row.html
    • /usr/share/doc/php-manual-en/function.mssql-field-length.html
    • /usr/share/doc/php-manual-en/function.mssql-field-name.html
    • /usr/share/doc/php-manual-en/function.mssql-field-seek.html
    • /usr/share/doc/php-manual-en/function.mssql-field-type.html
    • /usr/share/doc/php-manual-en/function.mssql-free-result.html
    • /usr/share/doc/php-manual-en/function.mssql-free-statement.html
    • /usr/share/doc/php-manual-en/function.mssql-get-last-message.html
    • /usr/share/doc/php-manual-en/function.mssql-guid-string.html
    • /usr/share/doc/php-manual-en/function.mssql-init.html
    • /usr/share/doc/php-manual-en/function.mssql-min-error-severity.html
    • /usr/share/doc/php-manual-en/function.mssql-min-message-severity.html
    • /usr/share/doc/php-manual-en/function.mssql-next-result.html
    • /usr/share/doc/php-manual-en/function.mssql-num-fields.html
    • /usr/share/doc/php-manual-en/function.mssql-num-rows.html
    • /usr/share/doc/php-manual-en/function.mssql-pconnect.html
    • /usr/share/doc/php-manual-en/function.mssql-query.html
    • /usr/share/doc/php-manual-en/function.mssql-result.html
    • /usr/share/doc/php-manual-en/function.mssql-rows-affected.html
    • /usr/share/doc/php-manual-en/function.mssql-select-db.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.mysql-affected-rows.html
    • /usr/share/doc/php-manual-en/function.mysql-client-encoding.html
    • /usr/share/doc/php-manual-en/function.mysql-close.html
    • /usr/share/doc/php-manual-en/function.mysql-connect.html
    • /usr/share/doc/php-manual-en/function.mysql-create-db.html
    • /usr/share/doc/php-manual-en/function.mysql-data-seek.html
    • /usr/share/doc/php-manual-en/function.mysql-db-name.html
    • /usr/share/doc/php-manual-en/function.mysql-db-query.html
    • /usr/share/doc/php-manual-en/function.mysql-drop-db.html
    • /usr/share/doc/php-manual-en/function.mysql-errno.html
    • /usr/share/doc/php-manual-en/function.mysql-error.html
    • /usr/share/doc/php-manual-en/function.mysql-escape-string.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-array.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-field.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-lengths.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-object.html
    • /usr/share/doc/php-manual-en/function.mysql-fetch-row.html
    • /usr/share/doc/php-manual-en/function.mysql-field-flags.html
    • /usr/share/doc/php-manual-en/function.mysql-field-len.html
    • /usr/share/doc/php-manual-en/function.mysql-field-name.html
    • /usr/share/doc/php-manual-en/function.mysql-field-seek.html
    • /usr/share/doc/php-manual-en/function.mysql-field-table.html
    • /usr/share/doc/php-manual-en/function.mysql-field-type.html
    • /usr/share/doc/php-manual-en/function.mysql-free-result.html
    • /usr/share/doc/php-manual-en/function.mysql-get-client-info.html
    • /usr/share/doc/php-manual-en/function.mysql-get-host-info.html
    • /usr/share/doc/php-manual-en/function.mysql-get-proto-info.html
    • /usr/share/doc/php-manual-en/function.mysql-get-server-info.html
    • /usr/share/doc/php-manual-en/function.mysql-info.html
    • /usr/share/doc/php-manual-en/function.mysql-insert-id.html
    • /usr/share/doc/php-manual-en/function.mysql-list-dbs.html
    • /usr/share/doc/php-manual-en/function.mysql-list-fields.html
    • /usr/share/doc/php-manual-en/function.mysql-list-processes.html
    • /usr/share/doc/php-manual-en/function.mysql-list-tables.html
    • /usr/share/doc/php-manual-en/function.mysql-num-fields.html
    • /usr/share/doc/php-manual-en/function.mysql-num-rows.html
    • /usr/share/doc/php-manual-en/function.mysql-pconnect.html
    • /usr/share/doc/php-manual-en/function.mysql-ping.html
    • /usr/share/doc/php-manual-en/function.mysql-query.html
    • /usr/share/doc/php-manual-en/function.mysql-real-escape-string.html
    • /usr/share/doc/php-manual-en/function.mysql-result.html
    • /usr/share/doc/php-manual-en/function.mysql-select-db.html
    • /usr/share/doc/php-manual-en/function.mysql-set-charset.html
    • /usr/share/doc/php-manual-en/function.mysql-stat.html
    • /usr/share/doc/php-manual-en/function.mysql-tablename.html
    • /usr/share/doc/php-manual-en/function.mysql-thread-id.html
    • /usr/share/doc/php-manual-en/function.mysql-unbuffered-query.html
    • /usr/share/doc/php-manual-en/function.mysqli-bind-param.html
    • /usr/share/doc/php-manual-en/function.mysqli-bind-result.html
    • /usr/share/doc/php-manual-en/function.mysqli-client-encoding.html
    • /usr/share/doc/php-manual-en/function.mysqli-connect.html
    • /usr/share/doc/php-manual-en/function.mysqli-disable-reads-from-master.html
    • /usr/share/doc/php-manual-en/function.mysqli-disable-rpl-parse.html
    • /usr/share/doc/php-manual-en/function.mysqli-enable-reads-from-master.html
    • /usr/share/doc/php-manual-en/function.mysqli-enable-rpl-parse.html
    • /usr/share/doc/php-manual-en/function.mysqli-escape-string.html
    • /usr/share/doc/php-manual-en/function.mysqli-execute.html
    • /usr/share/doc/php-manual-en/function.mysqli-fetch.html
    • /usr/share/doc/php-manual-en/function.mysqli-get-cache-stats.html
    • /usr/share/doc/php-manual-en/function.mysqli-get-metadata.html
    • /usr/share/doc/php-manual-en/function.mysqli-master-query.html
    • /usr/share/doc/php-manual-en/function.mysqli-param-count.html
    • /usr/share/doc/php-manual-en/function.mysqli-report.html
    • /usr/share/doc/php-manual-en/function.mysqli-rpl-parse-enabled.html
    • /usr/share/doc/php-manual-en/function.mysqli-rpl-probe.html
    • /usr/share/doc/php-manual-en/function.mysqli-send-long-data.html
    • /usr/share/doc/php-manual-en/function.mysqli-set-opt.html
    • /usr/share/doc/php-manual-en/function.mysqli-slave-query.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-memcache-get-config.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-memcache-set.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-get-last-gtid.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-get-last-used-connection.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-get-stats.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-match-wild.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-query-is-select.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-set-qos.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-ms-set-user-pick-server.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-clear-cache.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-get-available-handlers.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-get-cache-info.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-get-core-stats.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-get-normalized-query-trace-log.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-get-query-trace-log.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-set-cache-condition.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-set-is-select.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-set-storage-handler.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-qc-set-user-handlers.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-uh-convert-to-mysqlnd.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-uh-set-connection-proxy.html
    • /usr/share/doc/php-manual-en/function.mysqlnd-uh-set-statement-proxy.html
    • /usr/share/doc/php-manual-en/function.natcasesort.html
    • /usr/share/doc/php-manual-en/function.natsort.html
    • /usr/share/doc/php-manual-en/function.ncurses-addch.html
    • /usr/share/doc/php-manual-en/function.ncurses-addchnstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-addchstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-addnstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-addstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-assume-default-colors.html
    • /usr/share/doc/php-manual-en/function.ncurses-attroff.html
    • /usr/share/doc/php-manual-en/function.ncurses-attron.html
    • /usr/share/doc/php-manual-en/function.ncurses-attrset.html
    • /usr/share/doc/php-manual-en/function.ncurses-baudrate.html
    • /usr/share/doc/php-manual-en/function.ncurses-beep.html
    • /usr/share/doc/php-manual-en/function.ncurses-bkgd.html
    • /usr/share/doc/php-manual-en/function.ncurses-bkgdset.html
    • /usr/share/doc/php-manual-en/function.ncurses-border.html
    • /usr/share/doc/php-manual-en/function.ncurses-bottom-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-can-change-color.html
    • /usr/share/doc/php-manual-en/function.ncurses-cbreak.html
    • /usr/share/doc/php-manual-en/function.ncurses-clear.html
    • /usr/share/doc/php-manual-en/function.ncurses-clrtobot.html
    • /usr/share/doc/php-manual-en/function.ncurses-clrtoeol.html
    • /usr/share/doc/php-manual-en/function.ncurses-color-content.html
    • /usr/share/doc/php-manual-en/function.ncurses-color-set.html
    • /usr/share/doc/php-manual-en/function.ncurses-curs-set.html
    • /usr/share/doc/php-manual-en/function.ncurses-def-prog-mode.html
    • /usr/share/doc/php-manual-en/function.ncurses-def-shell-mode.html
    • /usr/share/doc/php-manual-en/function.ncurses-define-key.html
    • /usr/share/doc/php-manual-en/function.ncurses-del-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-delay-output.html
    • /usr/share/doc/php-manual-en/function.ncurses-delch.html
    • /usr/share/doc/php-manual-en/function.ncurses-deleteln.html
    • /usr/share/doc/php-manual-en/function.ncurses-delwin.html
    • /usr/share/doc/php-manual-en/function.ncurses-doupdate.html
    • /usr/share/doc/php-manual-en/function.ncurses-echo.html
    • /usr/share/doc/php-manual-en/function.ncurses-echochar.html
    • /usr/share/doc/php-manual-en/function.ncurses-end.html
    • /usr/share/doc/php-manual-en/function.ncurses-erase.html
    • /usr/share/doc/php-manual-en/function.ncurses-erasechar.html
    • /usr/share/doc/php-manual-en/function.ncurses-filter.html
    • /usr/share/doc/php-manual-en/function.ncurses-flash.html
    • /usr/share/doc/php-manual-en/function.ncurses-flushinp.html
    • /usr/share/doc/php-manual-en/function.ncurses-getch.html
    • /usr/share/doc/php-manual-en/function.ncurses-getmaxyx.html
    • /usr/share/doc/php-manual-en/function.ncurses-getmouse.html
    • /usr/share/doc/php-manual-en/function.ncurses-getyx.html
    • /usr/share/doc/php-manual-en/function.ncurses-halfdelay.html
    • /usr/share/doc/php-manual-en/function.ncurses-has-colors.html
    • /usr/share/doc/php-manual-en/function.ncurses-has-ic.html
    • /usr/share/doc/php-manual-en/function.ncurses-has-il.html
    • /usr/share/doc/php-manual-en/function.ncurses-has-key.html
    • /usr/share/doc/php-manual-en/function.ncurses-hide-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-hline.html
    • /usr/share/doc/php-manual-en/function.ncurses-inch.html
    • /usr/share/doc/php-manual-en/function.ncurses-init-color.html
    • /usr/share/doc/php-manual-en/function.ncurses-init-pair.html
    • /usr/share/doc/php-manual-en/function.ncurses-init.html
    • /usr/share/doc/php-manual-en/function.ncurses-insch.html
    • /usr/share/doc/php-manual-en/function.ncurses-insdelln.html
    • /usr/share/doc/php-manual-en/function.ncurses-insertln.html
    • /usr/share/doc/php-manual-en/function.ncurses-insstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-instr.html
    • /usr/share/doc/php-manual-en/function.ncurses-isendwin.html
    • /usr/share/doc/php-manual-en/function.ncurses-keyok.html
    • /usr/share/doc/php-manual-en/function.ncurses-keypad.html
    • /usr/share/doc/php-manual-en/function.ncurses-killchar.html
    • /usr/share/doc/php-manual-en/function.ncurses-longname.html
    • /usr/share/doc/php-manual-en/function.ncurses-meta.html
    • /usr/share/doc/php-manual-en/function.ncurses-mouse-trafo.html
    • /usr/share/doc/php-manual-en/function.ncurses-mouseinterval.html
    • /usr/share/doc/php-manual-en/function.ncurses-mousemask.html
    • /usr/share/doc/php-manual-en/function.ncurses-move-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-move.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvaddch.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvaddchnstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvaddchstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvaddnstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvaddstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvcur.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvdelch.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvgetch.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvhline.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvinch.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvvline.html
    • /usr/share/doc/php-manual-en/function.ncurses-mvwaddstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-napms.html
    • /usr/share/doc/php-manual-en/function.ncurses-new-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-newpad.html
    • /usr/share/doc/php-manual-en/function.ncurses-newwin.html
    • /usr/share/doc/php-manual-en/function.ncurses-nl.html
    • /usr/share/doc/php-manual-en/function.ncurses-nocbreak.html
    • /usr/share/doc/php-manual-en/function.ncurses-noecho.html
    • /usr/share/doc/php-manual-en/function.ncurses-nonl.html
    • /usr/share/doc/php-manual-en/function.ncurses-noqiflush.html
    • /usr/share/doc/php-manual-en/function.ncurses-noraw.html
    • /usr/share/doc/php-manual-en/function.ncurses-pair-content.html
    • /usr/share/doc/php-manual-en/function.ncurses-panel-above.html
    • /usr/share/doc/php-manual-en/function.ncurses-panel-below.html
    • /usr/share/doc/php-manual-en/function.ncurses-panel-window.html
    • /usr/share/doc/php-manual-en/function.ncurses-pnoutrefresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-prefresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-putp.html
    • /usr/share/doc/php-manual-en/function.ncurses-qiflush.html
    • /usr/share/doc/php-manual-en/function.ncurses-raw.html
    • /usr/share/doc/php-manual-en/function.ncurses-refresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-replace-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-reset-prog-mode.html
    • /usr/share/doc/php-manual-en/function.ncurses-reset-shell-mode.html
    • /usr/share/doc/php-manual-en/function.ncurses-resetty.html
    • /usr/share/doc/php-manual-en/function.ncurses-savetty.html
    • /usr/share/doc/php-manual-en/function.ncurses-scr-dump.html
    • /usr/share/doc/php-manual-en/function.ncurses-scr-init.html
    • /usr/share/doc/php-manual-en/function.ncurses-scr-restore.html
    • /usr/share/doc/php-manual-en/function.ncurses-scr-set.html
    • /usr/share/doc/php-manual-en/function.ncurses-scrl.html
    • /usr/share/doc/php-manual-en/function.ncurses-show-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-attr.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-attroff.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-attron.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-attrset.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-clear.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-color.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-init.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-noutrefresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-refresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-restore.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-set.html
    • /usr/share/doc/php-manual-en/function.ncurses-slk-touch.html
    • /usr/share/doc/php-manual-en/function.ncurses-standend.html
    • /usr/share/doc/php-manual-en/function.ncurses-standout.html
    • /usr/share/doc/php-manual-en/function.ncurses-start-color.html
    • /usr/share/doc/php-manual-en/function.ncurses-termattrs.html
    • /usr/share/doc/php-manual-en/function.ncurses-termname.html
    • /usr/share/doc/php-manual-en/function.ncurses-timeout.html
    • /usr/share/doc/php-manual-en/function.ncurses-top-panel.html
    • /usr/share/doc/php-manual-en/function.ncurses-typeahead.html
    • /usr/share/doc/php-manual-en/function.ncurses-ungetch.html
    • /usr/share/doc/php-manual-en/function.ncurses-ungetmouse.html
    • /usr/share/doc/php-manual-en/function.ncurses-update-panels.html
    • /usr/share/doc/php-manual-en/function.ncurses-use-default-colors.html
    • /usr/share/doc/php-manual-en/function.ncurses-use-env.html
    • /usr/share/doc/php-manual-en/function.ncurses-use-extended-names.html
    • /usr/share/doc/php-manual-en/function.ncurses-vidattr.html
    • /usr/share/doc/php-manual-en/function.ncurses-vline.html
    • /usr/share/doc/php-manual-en/function.ncurses-waddch.html
    • /usr/share/doc/php-manual-en/function.ncurses-waddstr.html
    • /usr/share/doc/php-manual-en/function.ncurses-wattroff.html
    • /usr/share/doc/php-manual-en/function.ncurses-wattron.html
    • /usr/share/doc/php-manual-en/function.ncurses-wattrset.html
    • /usr/share/doc/php-manual-en/function.ncurses-wborder.html
    • /usr/share/doc/php-manual-en/function.ncurses-wclear.html
    • /usr/share/doc/php-manual-en/function.ncurses-wcolor-set.html
    • /usr/share/doc/php-manual-en/function.ncurses-werase.html
    • /usr/share/doc/php-manual-en/function.ncurses-wgetch.html
    • /usr/share/doc/php-manual-en/function.ncurses-whline.html
    • /usr/share/doc/php-manual-en/function.ncurses-wmouse-trafo.html
    • /usr/share/doc/php-manual-en/function.ncurses-wmove.html
    • /usr/share/doc/php-manual-en/function.ncurses-wnoutrefresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-wrefresh.html
    • /usr/share/doc/php-manual-en/function.ncurses-wstandend.html
    • /usr/share/doc/php-manual-en/function.ncurses-wstandout.html
    • /usr/share/doc/php-manual-en/function.ncurses-wvline.html
    • /usr/share/doc/php-manual-en/function.newt-bell.html
    • /usr/share/doc/php-manual-en/function.newt-button-bar.html
    • /usr/share/doc/php-manual-en/function.newt-button.html
    • /usr/share/doc/php-manual-en/function.newt-centered-window.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-get-value.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-set-flags.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-set-value.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-add-item.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-find-item.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-get-current.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-get-entry-value.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-get-multi-selection.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-get-selection.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-multi.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-set-current.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-set-entry-value.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-set-entry.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree-set-width.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox-tree.html
    • /usr/share/doc/php-manual-en/function.newt-checkbox.html
    • /usr/share/doc/php-manual-en/function.newt-clear-key-buffer.html
    • /usr/share/doc/php-manual-en/function.newt-cls.html
    • /usr/share/doc/php-manual-en/function.newt-compact-button.html
    • /usr/share/doc/php-manual-en/function.newt-component-add-callback.html
    • /usr/share/doc/php-manual-en/function.newt-component-takes-focus.html
    • /usr/share/doc/php-manual-en/function.newt-create-grid.html
    • /usr/share/doc/php-manual-en/function.newt-cursor-off.html
    • /usr/share/doc/php-manual-en/function.newt-cursor-on.html
    • /usr/share/doc/php-manual-en/function.newt-delay.html
    • /usr/share/doc/php-manual-en/function.newt-draw-form.html
    • /usr/share/doc/php-manual-en/function.newt-draw-root-text.html
    • /usr/share/doc/php-manual-en/function.newt-entry-get-value.html
    • /usr/share/doc/php-manual-en/function.newt-entry-set-filter.html
    • /usr/share/doc/php-manual-en/function.newt-entry-set-flags.html
    • /usr/share/doc/php-manual-en/function.newt-entry-set.html
    • /usr/share/doc/php-manual-en/function.newt-entry.html
    • /usr/share/doc/php-manual-en/function.newt-finished.html
    • /usr/share/doc/php-manual-en/function.newt-form-add-component.html
    • /usr/share/doc/php-manual-en/function.newt-form-add-components.html
    • /usr/share/doc/php-manual-en/function.newt-form-add-hot-key.html
    • /usr/share/doc/php-manual-en/function.newt-form-destroy.html
    • /usr/share/doc/php-manual-en/function.newt-form-get-current.html
    • /usr/share/doc/php-manual-en/function.newt-form-run.html
    • /usr/share/doc/php-manual-en/function.newt-form-set-background.html
    • /usr/share/doc/php-manual-en/function.newt-form-set-height.html
    • /usr/share/doc/php-manual-en/function.newt-form-set-size.html
    • /usr/share/doc/php-manual-en/function.newt-form-set-timer.html
    • /usr/share/doc/php-manual-en/function.newt-form-set-width.html
    • /usr/share/doc/php-manual-en/function.newt-form-watch-fd.html
    • /usr/share/doc/php-manual-en/function.newt-form.html
    • /usr/share/doc/php-manual-en/function.newt-get-screen-size.html
    • /usr/share/doc/php-manual-en/function.newt-grid-add-components-to-form.html
    • /usr/share/doc/php-manual-en/function.newt-grid-basic-window.html
    • /usr/share/doc/php-manual-en/function.newt-grid-free.html
    • /usr/share/doc/php-manual-en/function.newt-grid-get-size.html
    • /usr/share/doc/php-manual-en/function.newt-grid-h-close-stacked.html
    • /usr/share/doc/php-manual-en/function.newt-grid-h-stacked.html
    • /usr/share/doc/php-manual-en/function.newt-grid-place.html
    • /usr/share/doc/php-manual-en/function.newt-grid-set-field.html
    • /usr/share/doc/php-manual-en/function.newt-grid-simple-window.html
    • /usr/share/doc/php-manual-en/function.newt-grid-v-close-stacked.html
    • /usr/share/doc/php-manual-en/function.newt-grid-v-stacked.html
    • /usr/share/doc/php-manual-en/function.newt-grid-wrapped-window-at.html
    • /usr/share/doc/php-manual-en/function.newt-grid-wrapped-window.html
    • /usr/share/doc/php-manual-en/function.newt-init.html
    • /usr/share/doc/php-manual-en/function.newt-label-set-text.html
    • /usr/share/doc/php-manual-en/function.newt-label.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-append-entry.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-clear-selection.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-clear.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-delete-entry.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-get-current.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-get-selection.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-insert-entry.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-item-count.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-select-item.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-set-current-by-key.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-set-current.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-set-data.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-set-entry.html
    • /usr/share/doc/php-manual-en/function.newt-listbox-set-width.html
    • /usr/share/doc/php-manual-en/function.newt-listbox.html
    • /usr/share/doc/php-manual-en/function.newt-listitem-get-data.html
    • /usr/share/doc/php-manual-en/function.newt-listitem-set.html
    • /usr/share/doc/php-manual-en/function.newt-listitem.html
    • /usr/share/doc/php-manual-en/function.newt-open-window.html
    • /usr/share/doc/php-manual-en/function.newt-pop-help-line.html
    • /usr/share/doc/php-manual-en/function.newt-pop-window.html
    • /usr/share/doc/php-manual-en/function.newt-push-help-line.html
    • /usr/share/doc/php-manual-en/function.newt-radio-get-current.html
    • /usr/share/doc/php-manual-en/function.newt-radiobutton.html
    • /usr/share/doc/php-manual-en/function.newt-redraw-help-line.html
    • /usr/share/doc/php-manual-en/function.newt-reflow-text.html
    • /usr/share/doc/php-manual-en/function.newt-refresh.html
    • /usr/share/doc/php-manual-en/function.newt-resize-screen.html
    • /usr/share/doc/php-manual-en/function.newt-resume.html
    • /usr/share/doc/php-manual-en/function.newt-run-form.html
    • /usr/share/doc/php-manual-en/function.newt-scale-set.html
    • /usr/share/doc/php-manual-en/function.newt-scale.html
    • /usr/share/doc/php-manual-en/function.newt-scrollbar-set.html
    • /usr/share/doc/php-manual-en/function.newt-set-help-callback.html
    • /usr/share/doc/php-manual-en/function.newt-set-suspend-callback.html
    • /usr/share/doc/php-manual-en/function.newt-suspend.html
    • /usr/share/doc/php-manual-en/function.newt-textbox-get-num-lines.html
    • /usr/share/doc/php-manual-en/function.newt-textbox-reflowed.html
    • /usr/share/doc/php-manual-en/function.newt-textbox-set-height.html
    • /usr/share/doc/php-manual-en/function.newt-textbox-set-text.html
    • /usr/share/doc/php-manual-en/function.newt-textbox.html
    • /usr/share/doc/php-manual-en/function.newt-vertical-scrollbar.html
    • /usr/share/doc/php-manual-en/function.newt-wait-for-key.html
    • /usr/share/doc/php-manual-en/function.newt-win-choice.html
    • /usr/share/doc/php-manual-en/function.newt-win-entries.html
    • /usr/share/doc/php-manual-en/function.newt-win-menu.html
    • /usr/share/doc/php-manual-en/function.newt-win-message.html
    • /usr/share/doc/php-manual-en/function.newt-win-messagev.html
    • /usr/share/doc/php-manual-en/function.newt-win-ternary.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.ngettext.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.nl2br.html
    • /usr/share/doc/php-manual-en/function.notes-body.html
    • /usr/share/doc/php-manual-en/function.notes-copy-db.html
    • /usr/share/doc/php-manual-en/function.notes-create-db.html
    • /usr/share/doc/php-manual-en/function.notes-create-note.html
    • /usr/share/doc/php-manual-en/function.notes-drop-db.html
    • /usr/share/doc/php-manual-en/function.notes-find-note.html
    • /usr/share/doc/php-manual-en/function.notes-header-info.html
    • /usr/share/doc/php-manual-en/function.notes-list-msgs.html
    • /usr/share/doc/php-manual-en/function.notes-mark-read.html
    • /usr/share/doc/php-manual-en/function.notes-mark-unread.html
    • /usr/share/doc/php-manual-en/function.notes-nav-create.html
    • /usr/share/doc/php-manual-en/function.notes-search.html
    • /usr/share/doc/php-manual-en/function.notes-unread.html
    • /usr/share/doc/php-manual-en/function.notes-version.html
    • /usr/share/doc/php-manual-en/function.nsapi-request-headers.html
    • /usr/share/doc/php-manual-en/function.nsapi-response-headers.html
    • /usr/share/doc/php-manual-en/function.nsapi-virtual.html
    • /usr/share/doc/php-manual-en/function.nthmac.html
    • /usr/share/doc/php-manual-en/function.number-format.html
    • /usr/share/doc/php-manual-en/function.oauth-get-sbs.html
    • /usr/share/doc/php-manual-en/function.oauth-urlencode.html
    • /usr/share/doc/php-manual-en/function.ob-clean.html
    • /usr/share/doc/php-manual-en/function.ob-deflatehandler.html
    • /usr/share/doc/php-manual-en/function.ob-end-clean.html
    • /usr/share/doc/php-manual-en/function.ob-end-flush.html
    • /usr/share/doc/php-manual-en/function.ob-etaghandler.html
    • /usr/share/doc/php-manual-en/function.ob-flush.html
    • /usr/share/doc/php-manual-en/function.ob-get-clean.html
    • /usr/share/doc/php-manual-en/function.ob-get-contents.html
    • /usr/share/doc/php-manual-en/function.ob-get-flush.html
    • /usr/share/doc/php-manual-en/function.ob-get-length.html
    • /usr/share/doc/php-manual-en/function.ob-get-level.html
    • /usr/share/doc/php-manual-en/function.ob-get-status.html
    • /usr/share/doc/php-manual-en/function.ob-gzhandler.html
    • /usr/share/doc/php-manual-en/function.ob-iconv-handler.html
    • /usr/share/doc/php-manual-en/function.ob-implicit-flush.html
    • /usr/share/doc/php-manual-en/function.ob-inflatehandler.html
    • /usr/share/doc/php-manual-en/function.ob-list-handlers.html
    • /usr/share/doc/php-manual-en/function.ob-start.html
    • /usr/share/doc/php-manual-en/function.ob-tidyhandler.html
    • /usr/share/doc/php-manual-en/function.oci-bind-array-by-name.html
    • /usr/share/doc/php-manual-en/function.oci-bind-by-name.html
    • /usr/share/doc/php-manual-en/function.oci-cancel.html
    • /usr/share/doc/php-manual-en/function.oci-client-version.html
    • /usr/share/doc/php-manual-en/function.oci-close.html
    • /usr/share/doc/php-manual-en/function.oci-commit.html
    • /usr/share/doc/php-manual-en/function.oci-connect.html
    • /usr/share/doc/php-manual-en/function.oci-define-by-name.html
    • /usr/share/doc/php-manual-en/function.oci-error.html
    • /usr/share/doc/php-manual-en/function.oci-execute.html
    • /usr/share/doc/php-manual-en/function.oci-fetch-all.html
    • /usr/share/doc/php-manual-en/function.oci-fetch-array.html
    • /usr/share/doc/php-manual-en/function.oci-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.oci-fetch-object.html
    • /usr/share/doc/php-manual-en/function.oci-fetch-row.html
    • /usr/share/doc/php-manual-en/function.oci-fetch.html
    • /usr/share/doc/php-manual-en/function.oci-field-is-null.html
    • /usr/share/doc/php-manual-en/function.oci-field-name.html
    • /usr/share/doc/php-manual-en/function.oci-field-precision.html
    • /usr/share/doc/php-manual-en/function.oci-field-scale.html
    • /usr/share/doc/php-manual-en/function.oci-field-size.html
    • /usr/share/doc/php-manual-en/function.oci-field-type-raw.html
    • /usr/share/doc/php-manual-en/function.oci-field-type.html
    • /usr/share/doc/php-manual-en/function.oci-free-descriptor.html
    • /usr/share/doc/php-manual-en/function.oci-free-statement.html
    • /usr/share/doc/php-manual-en/function.oci-get-implicit-resultset.html
    • /usr/share/doc/php-manual-en/function.oci-internal-debug.html
    • /usr/share/doc/php-manual-en/function.oci-lob-copy.html
    • /usr/share/doc/php-manual-en/function.oci-lob-is-equal.html
    • /usr/share/doc/php-manual-en/function.oci-new-collection.html
    • /usr/share/doc/php-manual-en/function.oci-new-connect.html
    • /usr/share/doc/php-manual-en/function.oci-new-cursor.html
    • /usr/share/doc/php-manual-en/function.oci-new-descriptor.html
    • /usr/share/doc/php-manual-en/function.oci-num-fields.html
    • /usr/share/doc/php-manual-en/function.oci-num-rows.html
    • /usr/share/doc/php-manual-en/function.oci-parse.html
    • /usr/share/doc/php-manual-en/function.oci-password-change.html
    • /usr/share/doc/php-manual-en/function.oci-pconnect.html
    • /usr/share/doc/php-manual-en/function.oci-result.html
    • /usr/share/doc/php-manual-en/function.oci-rollback.html
    • /usr/share/doc/php-manual-en/function.oci-server-version.html
    • /usr/share/doc/php-manual-en/function.oci-set-action.html
    • /usr/share/doc/php-manual-en/function.oci-set-client-identifier.html
    • /usr/share/doc/php-manual-en/function.oci-set-client-info.html
    • /usr/share/doc/php-manual-en/function.oci-set-edition.html
    • /usr/share/doc/php-manual-en/function.oci-set-module-name.html
    • /usr/share/doc/php-manual-en/function.oci-set-prefetch.html
    • /usr/share/doc/php-manual-en/function.oci-statement-type.html
    • /usr/share/doc/php-manual-en/function.ocibindbyname.html
    • /usr/share/doc/php-manual-en/function.ocicancel.html
    • /usr/share/doc/php-manual-en/function.ocicloselob.html
    • /usr/share/doc/php-manual-en/function.ocicollappend.html
    • /usr/share/doc/php-manual-en/function.ocicollassign.html
    • /usr/share/doc/php-manual-en/function.ocicollassignelem.html
    • /usr/share/doc/php-manual-en/function.ocicollgetelem.html
    • /usr/share/doc/php-manual-en/function.ocicollmax.html
    • /usr/share/doc/php-manual-en/function.ocicollsize.html
    • /usr/share/doc/php-manual-en/function.ocicolltrim.html
    • /usr/share/doc/php-manual-en/function.ocicolumnisnull.html
    • /usr/share/doc/php-manual-en/function.ocicolumnname.html
    • /usr/share/doc/php-manual-en/function.ocicolumnprecision.html
    • /usr/share/doc/php-manual-en/function.ocicolumnscale.html
    • /usr/share/doc/php-manual-en/function.ocicolumnsize.html
    • /usr/share/doc/php-manual-en/function.ocicolumntype.html
    • /usr/share/doc/php-manual-en/function.ocicolumntyperaw.html
    • /usr/share/doc/php-manual-en/function.ocicommit.html
    • /usr/share/doc/php-manual-en/function.ocidefinebyname.html
    • /usr/share/doc/php-manual-en/function.ocierror.html
    • /usr/share/doc/php-manual-en/function.ociexecute.html
    • /usr/share/doc/php-manual-en/function.ocifetch.html
    • /usr/share/doc/php-manual-en/function.ocifetchinto.html
    • /usr/share/doc/php-manual-en/function.ocifetchstatement.html
    • /usr/share/doc/php-manual-en/function.ocifreecollection.html
    • /usr/share/doc/php-manual-en/function.ocifreecursor.html
    • /usr/share/doc/php-manual-en/function.ocifreedesc.html
    • /usr/share/doc/php-manual-en/function.ocifreestatement.html
    • /usr/share/doc/php-manual-en/function.ociinternaldebug.html
    • /usr/share/doc/php-manual-en/function.ociloadlob.html
    • /usr/share/doc/php-manual-en/function.ocilogoff.html
    • /usr/share/doc/php-manual-en/function.ocilogon.html
    • /usr/share/doc/php-manual-en/function.ocinewcollection.html
    • /usr/share/doc/php-manual-en/function.ocinewcursor.html
    • /usr/share/doc/php-manual-en/function.ocinewdescriptor.html
    • /usr/share/doc/php-manual-en/function.ocinlogon.html
    • /usr/share/doc/php-manual-en/function.ocinumcols.html
    • /usr/share/doc/php-manual-en/function.ociparse.html
    • /usr/share/doc/php-manual-en/function.ociplogon.html
    • /usr/share/doc/php-manual-en/function.ociresult.html
    • /usr/share/doc/php-manual-en/function.ocirollback.html
    • /usr/share/doc/php-manual-en/function.ocirowcount.html
    • /usr/share/doc/php-manual-en/function.ocisavelob.html
    • /usr/share/doc/php-manual-en/function.ocisavelobfile.html
    • /usr/share/doc/php-manual-en/function.ociserverversion.html
    • /usr/share/doc/php-manual-en/function.ocisetprefetch.html
    • /usr/share/doc/php-manual-en/function.ocistatementtype.html
    • /usr/share/doc/php-manual-en/function.ociwritelobtofile.html
    • /usr/share/doc/php-manual-en/function.ociwritetemporarylob.html
    • /usr/share/doc/php-manual-en/function.octdec.html
    • /usr/share/doc/php-manual-en/function.odbc-autocommit.html
    • /usr/share/doc/php-manual-en/function.odbc-binmode.html
    • /usr/share/doc/php-manual-en/function.odbc-close-all.html
    • /usr/share/doc/php-manual-en/function.odbc-close.html
    • /usr/share/doc/php-manual-en/function.odbc-columnprivileges.html
    • /usr/share/doc/php-manual-en/function.odbc-columns.html
    • /usr/share/doc/php-manual-en/function.odbc-commit.html
    • /usr/share/doc/php-manual-en/function.odbc-connect.html
    • /usr/share/doc/php-manual-en/function.odbc-cursor.html
    • /usr/share/doc/php-manual-en/function.odbc-data-source.html
    • /usr/share/doc/php-manual-en/function.odbc-do.html
    • /usr/share/doc/php-manual-en/function.odbc-error.html
    • /usr/share/doc/php-manual-en/function.odbc-errormsg.html
    • /usr/share/doc/php-manual-en/function.odbc-exec.html
    • /usr/share/doc/php-manual-en/function.odbc-execute.html
    • /usr/share/doc/php-manual-en/function.odbc-fetch-array.html
    • /usr/share/doc/php-manual-en/function.odbc-fetch-into.html
    • /usr/share/doc/php-manual-en/function.odbc-fetch-object.html
    • /usr/share/doc/php-manual-en/function.odbc-fetch-row.html
    • /usr/share/doc/php-manual-en/function.odbc-field-len.html
    • /usr/share/doc/php-manual-en/function.odbc-field-name.html
    • /usr/share/doc/php-manual-en/function.odbc-field-num.html
    • /usr/share/doc/php-manual-en/function.odbc-field-precision.html
    • /usr/share/doc/php-manual-en/function.odbc-field-scale.html
    • /usr/share/doc/php-manual-en/function.odbc-field-type.html
    • /usr/share/doc/php-manual-en/function.odbc-foreignkeys.html
    • /usr/share/doc/php-manual-en/function.odbc-free-result.html
    • /usr/share/doc/php-manual-en/function.odbc-gettypeinfo.html
    • /usr/share/doc/php-manual-en/function.odbc-longreadlen.html
    • /usr/share/doc/php-manual-en/function.odbc-next-result.html
    • /usr/share/doc/php-manual-en/function.odbc-num-fields.html
    • /usr/share/doc/php-manual-en/function.odbc-num-rows.html
    • /usr/share/doc/php-manual-en/function.odbc-pconnect.html
    • /usr/share/doc/php-manual-en/function.odbc-prepare.html
    • /usr/share/doc/php-manual-en/function.odbc-primarykeys.html
    • /usr/share/doc/php-manual-en/function.odbc-procedurecolumns.html
    • /usr/share/doc/php-manual-en/function.odbc-procedures.html
    • /usr/share/doc/php-manual-en/function.odbc-result-all.html
    • /usr/share/doc/php-manual-en/function.odbc-result.html
    • /usr/share/doc/php-manual-en/function.odbc-rollback.html
    • /usr/share/doc/php-manual-en/function.odbc-setoption.html
    • /usr/share/doc/php-manual-en/function.odbc-specialcolumns.html
    • /usr/share/doc/php-manual-en/function.odbc-statistics.html
    • /usr/share/doc/php-manual-en/function.odbc-tableprivileges.html
    • /usr/share/doc/php-manual-en/function.odbc-tables.html
    • /usr/share/doc/php-manual-en/function.opcache-compile-file.html
    • /usr/share/doc/php-manual-en/function.opcache-get-configuration.html
    • /usr/share/doc/php-manual-en/function.opcache-get-status.html
    • /usr/share/doc/php-manual-en/function.opcache-invalidate.html
    • /usr/share/doc/php-manual-en/function.opcache-reset.html
    • /usr/share/doc/php-manual-en/function.openal-buffer-create.html
    • /usr/share/doc/php-manual-en/function.openal-buffer-data.html
    • /usr/share/doc/php-manual-en/function.openal-buffer-destroy.html
    • /usr/share/doc/php-manual-en/function.openal-buffer-get.html
    • /usr/share/doc/php-manual-en/function.openal-buffer-loadwav.html
    • /usr/share/doc/php-manual-en/function.openal-context-create.html
    • /usr/share/doc/php-manual-en/function.openal-context-current.html
    • /usr/share/doc/php-manual-en/function.openal-context-destroy.html
    • /usr/share/doc/php-manual-en/function.openal-context-process.html
    • /usr/share/doc/php-manual-en/function.openal-context-suspend.html
    • /usr/share/doc/php-manual-en/function.openal-device-close.html
    • /usr/share/doc/php-manual-en/function.openal-device-open.html
    • /usr/share/doc/php-manual-en/function.openal-listener-get.html
    • /usr/share/doc/php-manual-en/function.openal-listener-set.html
    • /usr/share/doc/php-manual-en/function.openal-source-create.html
    • /usr/share/doc/php-manual-en/function.openal-source-destroy.html
    • /usr/share/doc/php-manual-en/function.openal-source-get.html
    • /usr/share/doc/php-manual-en/function.openal-source-pause.html
    • /usr/share/doc/php-manual-en/function.openal-source-play.html
    • /usr/share/doc/php-manual-en/function.openal-source-rewind.html
    • /usr/share/doc/php-manual-en/function.openal-source-set.html
    • /usr/share/doc/php-manual-en/function.openal-source-stop.html
    • /usr/share/doc/php-manual-en/function.openal-stream.html
    • /usr/share/doc/php-manual-en/function.opendir.html
    • /usr/share/doc/php-manual-en/function.openlog.html
    • /usr/share/doc/php-manual-en/function.openssl-cipher-iv-length.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-export-to-file.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-export.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-get-public-key.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-get-subject.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-new.html
    • /usr/share/doc/php-manual-en/function.openssl-csr-sign.html
    • /usr/share/doc/php-manual-en/function.openssl-decrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-dh-compute-key.html
    • /usr/share/doc/php-manual-en/function.openssl-digest.html
    • /usr/share/doc/php-manual-en/function.openssl-encrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-error-string.html
    • /usr/share/doc/php-manual-en/function.openssl-free-key.html
    • /usr/share/doc/php-manual-en/function.openssl-get-cipher-methods.html
    • /usr/share/doc/php-manual-en/function.openssl-get-md-methods.html
    • /usr/share/doc/php-manual-en/function.openssl-get-privatekey.html
    • /usr/share/doc/php-manual-en/function.openssl-get-publickey.html
    • /usr/share/doc/php-manual-en/function.openssl-open.html
    • /usr/share/doc/php-manual-en/function.openssl-pbkdf2.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs12-export-to-file.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs12-export.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs12-read.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs7-decrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs7-encrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs7-sign.html
    • /usr/share/doc/php-manual-en/function.openssl-pkcs7-verify.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-export-to-file.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-export.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-free.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-get-details.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-get-private.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-get-public.html
    • /usr/share/doc/php-manual-en/function.openssl-pkey-new.html
    • /usr/share/doc/php-manual-en/function.openssl-private-decrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-private-encrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-public-decrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-public-encrypt.html
    • /usr/share/doc/php-manual-en/function.openssl-random-pseudo-bytes.html
    • /usr/share/doc/php-manual-en/function.openssl-seal.html
    • /usr/share/doc/php-manual-en/function.openssl-sign.html
    • /usr/share/doc/php-manual-en/function.openssl-verify.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-check-private-key.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-checkpurpose.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-export-to-file.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-export.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-free.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-parse.html
    • /usr/share/doc/php-manual-en/function.openssl-x509-read.html
    • /usr/share/doc/php-manual-en/function.ord.html
    • /usr/share/doc/php-manual-en/function.output-add-rewrite-var.html
    • /usr/share/doc/php-manual-en/function.output-reset-rewrite-vars.html
    • /usr/share/doc/php-manual-en/function.override-function.html
    • /usr/share/doc/php-manual-en/function.ovrimos-close.html
    • /usr/share/doc/php-manual-en/function.ovrimos-commit.html
    • /usr/share/doc/php-manual-en/function.ovrimos-connect.html
    • /usr/share/doc/php-manual-en/function.ovrimos-cursor.html
    • /usr/share/doc/php-manual-en/function.ovrimos-exec.html
    • /usr/share/doc/php-manual-en/function.ovrimos-execute.html
    • /usr/share/doc/php-manual-en/function.ovrimos-fetch-into.html
    • /usr/share/doc/php-manual-en/function.ovrimos-fetch-row.html
    • /usr/share/doc/php-manual-en/function.ovrimos-field-len.html
    • /usr/share/doc/php-manual-en/function.ovrimos-field-name.html
    • /usr/share/doc/php-manual-en/function.ovrimos-field-num.html
    • /usr/share/doc/php-manual-en/function.ovrimos-field-type.html
    • /usr/share/doc/php-manual-en/function.ovrimos-free-result.html
    • /usr/share/doc/php-manual-en/function.ovrimos-longreadlen.html
    • /usr/share/doc/php-manual-en/function.ovrimos-num-fields.html
    • /usr/share/doc/php-manual-en/function.ovrimos-num-rows.html
    • /usr/share/doc/php-manual-en/function.ovrimos-prepare.html
    • /usr/share/doc/php-manual-en/function.ovrimos-result-all.html
    • /usr/share/doc/php-manual-en/function.ovrimos-result.html
    • /usr/share/doc/php-manual-en/function.ovrimos-rollback.html
    • /usr/share/doc/php-manual-en/function.pack.html
    • /usr/share/doc/php-manual-en/function.parse-ini-file.html
    • /usr/share/doc/php-manual-en/function.parse-ini-string.html
    • /usr/share/doc/php-manual-en/function.parse-str.html
    • /usr/share/doc/php-manual-en/function.parse-url.html
    • /usr/share/doc/php-manual-en/function.parsekit-compile-file.html
    • /usr/share/doc/php-manual-en/function.parsekit-compile-string.html
    • /usr/share/doc/php-manual-en/function.parsekit-func-arginfo.html
    • /usr/share/doc/php-manual-en/function.passthru.html
    • /usr/share/doc/php-manual-en/function.password-get-info.html
    • /usr/share/doc/php-manual-en/function.password-hash.html
    • /usr/share/doc/php-manual-en/function.password-needs-rehash.html
    • /usr/share/doc/php-manual-en/function.password-verify.html
    • /usr/share/doc/php-manual-en/function.pathinfo.html
    • /usr/share/doc/php-manual-en/function.pclose.html
    • /usr/share/doc/php-manual-en/function.pcntl-alarm.html
    • /usr/share/doc/php-manual-en/function.pcntl-errno.html
    • /usr/share/doc/php-manual-en/function.pcntl-exec.html
    • /usr/share/doc/php-manual-en/function.pcntl-fork.html
    • /usr/share/doc/php-manual-en/function.pcntl-get-last-error.html
    • /usr/share/doc/php-manual-en/function.pcntl-getpriority.html
    • /usr/share/doc/php-manual-en/function.pcntl-setpriority.html
    • /usr/share/doc/php-manual-en/function.pcntl-signal-dispatch.html
    • /usr/share/doc/php-manual-en/function.pcntl-signal.html
    • /usr/share/doc/php-manual-en/function.pcntl-sigprocmask.html
    • /usr/share/doc/php-manual-en/function.pcntl-sigtimedwait.html
    • /usr/share/doc/php-manual-en/function.pcntl-sigwaitinfo.html
    • /usr/share/doc/php-manual-en/function.pcntl-strerror.html
    • /usr/share/doc/php-manual-en/function.pcntl-wait.html
    • /usr/share/doc/php-manual-en/function.pcntl-waitpid.html
    • /usr/share/doc/php-manual-en/function.pcntl-wexitstatus.html
    • /usr/share/doc/php-manual-en/function.pcntl-wifexited.html
    • /usr/share/doc/php-manual-en/function.pcntl-wifsignaled.html
    • /usr/share/doc/php-manual-en/function.pcntl-wifstopped.html
    • /usr/share/doc/php-manual-en/function.pcntl-wstopsig.html
    • /usr/share/doc/php-manual-en/function.pcntl-wtermsig.html
    • /usr/share/doc/php-manual-en/function.pdf-activate-item.html
    • /usr/share/doc/php-manual-en/function.pdf-add-annotation.html
    • /usr/share/doc/php-manual-en/function.pdf-add-bookmark.html
    • /usr/share/doc/php-manual-en/function.pdf-add-launchlink.html
    • /usr/share/doc/php-manual-en/function.pdf-add-locallink.html
    • /usr/share/doc/php-manual-en/function.pdf-add-nameddest.html
    • /usr/share/doc/php-manual-en/function.pdf-add-note.html
    • /usr/share/doc/php-manual-en/function.pdf-add-outline.html
    • /usr/share/doc/php-manual-en/function.pdf-add-pdflink.html
    • /usr/share/doc/php-manual-en/function.pdf-add-table-cell.html
    • /usr/share/doc/php-manual-en/function.pdf-add-textflow.html
    • /usr/share/doc/php-manual-en/function.pdf-add-thumbnail.html
    • /usr/share/doc/php-manual-en/function.pdf-add-weblink.html
    • /usr/share/doc/php-manual-en/function.pdf-arc.html
    • /usr/share/doc/php-manual-en/function.pdf-arcn.html
    • /usr/share/doc/php-manual-en/function.pdf-attach-file.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-document.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-font.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-glyph.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-item.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-layer.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-page-ext.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-page.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-pattern.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-template-ext.html
    • /usr/share/doc/php-manual-en/function.pdf-begin-template.html
    • /usr/share/doc/php-manual-en/function.pdf-circle.html
    • /usr/share/doc/php-manual-en/function.pdf-clip.html
    • /usr/share/doc/php-manual-en/function.pdf-close-image.html
    • /usr/share/doc/php-manual-en/function.pdf-close-pdi-page.html
    • /usr/share/doc/php-manual-en/function.pdf-close-pdi.html
    • /usr/share/doc/php-manual-en/function.pdf-close.html
    • /usr/share/doc/php-manual-en/function.pdf-closepath-fill-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-closepath-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-closepath.html
    • /usr/share/doc/php-manual-en/function.pdf-concat.html
    • /usr/share/doc/php-manual-en/function.pdf-continue-text.html
    • /usr/share/doc/php-manual-en/function.pdf-create-3dview.html
    • /usr/share/doc/php-manual-en/function.pdf-create-action.html
    • /usr/share/doc/php-manual-en/function.pdf-create-annotation.html
    • /usr/share/doc/php-manual-en/function.pdf-create-bookmark.html
    • /usr/share/doc/php-manual-en/function.pdf-create-field.html
    • /usr/share/doc/php-manual-en/function.pdf-create-fieldgroup.html
    • /usr/share/doc/php-manual-en/function.pdf-create-gstate.html
    • /usr/share/doc/php-manual-en/function.pdf-create-pvf.html
    • /usr/share/doc/php-manual-en/function.pdf-create-textflow.html
    • /usr/share/doc/php-manual-en/function.pdf-curveto.html
    • /usr/share/doc/php-manual-en/function.pdf-define-layer.html
    • /usr/share/doc/php-manual-en/function.pdf-delete-pvf.html
    • /usr/share/doc/php-manual-en/function.pdf-delete-table.html
    • /usr/share/doc/php-manual-en/function.pdf-delete-textflow.html
    • /usr/share/doc/php-manual-en/function.pdf-delete.html
    • /usr/share/doc/php-manual-en/function.pdf-encoding-set-char.html
    • /usr/share/doc/php-manual-en/function.pdf-end-document.html
    • /usr/share/doc/php-manual-en/function.pdf-end-font.html
    • /usr/share/doc/php-manual-en/function.pdf-end-glyph.html
    • /usr/share/doc/php-manual-en/function.pdf-end-item.html
    • /usr/share/doc/php-manual-en/function.pdf-end-layer.html
    • /usr/share/doc/php-manual-en/function.pdf-end-page-ext.html
    • /usr/share/doc/php-manual-en/function.pdf-end-page.html
    • /usr/share/doc/php-manual-en/function.pdf-end-pattern.html
    • /usr/share/doc/php-manual-en/function.pdf-end-template.html
    • /usr/share/doc/php-manual-en/function.pdf-endpath.html
    • /usr/share/doc/php-manual-en/function.pdf-fill-imageblock.html
    • /usr/share/doc/php-manual-en/function.pdf-fill-pdfblock.html
    • /usr/share/doc/php-manual-en/function.pdf-fill-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-fill-textblock.html
    • /usr/share/doc/php-manual-en/function.pdf-fill.html
    • /usr/share/doc/php-manual-en/function.pdf-findfont.html
    • /usr/share/doc/php-manual-en/function.pdf-fit-image.html
    • /usr/share/doc/php-manual-en/function.pdf-fit-pdi-page.html
    • /usr/share/doc/php-manual-en/function.pdf-fit-table.html
    • /usr/share/doc/php-manual-en/function.pdf-fit-textflow.html
    • /usr/share/doc/php-manual-en/function.pdf-fit-textline.html
    • /usr/share/doc/php-manual-en/function.pdf-get-apiname.html
    • /usr/share/doc/php-manual-en/function.pdf-get-buffer.html
    • /usr/share/doc/php-manual-en/function.pdf-get-errmsg.html
    • /usr/share/doc/php-manual-en/function.pdf-get-errnum.html
    • /usr/share/doc/php-manual-en/function.pdf-get-font.html
    • /usr/share/doc/php-manual-en/function.pdf-get-fontname.html
    • /usr/share/doc/php-manual-en/function.pdf-get-fontsize.html
    • /usr/share/doc/php-manual-en/function.pdf-get-image-height.html
    • /usr/share/doc/php-manual-en/function.pdf-get-image-width.html
    • /usr/share/doc/php-manual-en/function.pdf-get-majorversion.html
    • /usr/share/doc/php-manual-en/function.pdf-get-minorversion.html
    • /usr/share/doc/php-manual-en/function.pdf-get-parameter.html
    • /usr/share/doc/php-manual-en/function.pdf-get-pdi-parameter.html
    • /usr/share/doc/php-manual-en/function.pdf-get-pdi-value.html
    • /usr/share/doc/php-manual-en/function.pdf-get-value.html
    • /usr/share/doc/php-manual-en/function.pdf-info-font.html
    • /usr/share/doc/php-manual-en/function.pdf-info-matchbox.html
    • /usr/share/doc/php-manual-en/function.pdf-info-table.html
    • /usr/share/doc/php-manual-en/function.pdf-info-textflow.html
    • /usr/share/doc/php-manual-en/function.pdf-info-textline.html
    • /usr/share/doc/php-manual-en/function.pdf-initgraphics.html
    • /usr/share/doc/php-manual-en/function.pdf-lineto.html
    • /usr/share/doc/php-manual-en/function.pdf-load-3ddata.html
    • /usr/share/doc/php-manual-en/function.pdf-load-font.html
    • /usr/share/doc/php-manual-en/function.pdf-load-iccprofile.html
    • /usr/share/doc/php-manual-en/function.pdf-load-image.html
    • /usr/share/doc/php-manual-en/function.pdf-makespotcolor.html
    • /usr/share/doc/php-manual-en/function.pdf-moveto.html
    • /usr/share/doc/php-manual-en/function.pdf-new.html
    • /usr/share/doc/php-manual-en/function.pdf-open-ccitt.html
    • /usr/share/doc/php-manual-en/function.pdf-open-file.html
    • /usr/share/doc/php-manual-en/function.pdf-open-gif.html
    • /usr/share/doc/php-manual-en/function.pdf-open-image-file.html
    • /usr/share/doc/php-manual-en/function.pdf-open-image.html
    • /usr/share/doc/php-manual-en/function.pdf-open-jpeg.html
    • /usr/share/doc/php-manual-en/function.pdf-open-memory-image.html
    • /usr/share/doc/php-manual-en/function.pdf-open-pdi-document.html
    • /usr/share/doc/php-manual-en/function.pdf-open-pdi-page.html
    • /usr/share/doc/php-manual-en/function.pdf-open-pdi.html
    • /usr/share/doc/php-manual-en/function.pdf-open-tiff.html
    • /usr/share/doc/php-manual-en/function.pdf-pcos-get-number.html
    • /usr/share/doc/php-manual-en/function.pdf-pcos-get-stream.html
    • /usr/share/doc/php-manual-en/function.pdf-pcos-get-string.html
    • /usr/share/doc/php-manual-en/function.pdf-place-image.html
    • /usr/share/doc/php-manual-en/function.pdf-place-pdi-page.html
    • /usr/share/doc/php-manual-en/function.pdf-process-pdi.html
    • /usr/share/doc/php-manual-en/function.pdf-rect.html
    • /usr/share/doc/php-manual-en/function.pdf-restore.html
    • /usr/share/doc/php-manual-en/function.pdf-resume-page.html
    • /usr/share/doc/php-manual-en/function.pdf-rotate.html
    • /usr/share/doc/php-manual-en/function.pdf-save.html
    • /usr/share/doc/php-manual-en/function.pdf-scale.html
    • /usr/share/doc/php-manual-en/function.pdf-set-border-color.html
    • /usr/share/doc/php-manual-en/function.pdf-set-border-dash.html
    • /usr/share/doc/php-manual-en/function.pdf-set-border-style.html
    • /usr/share/doc/php-manual-en/function.pdf-set-char-spacing.html
    • /usr/share/doc/php-manual-en/function.pdf-set-duration.html
    • /usr/share/doc/php-manual-en/function.pdf-set-gstate.html
    • /usr/share/doc/php-manual-en/function.pdf-set-horiz-scaling.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info-author.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info-creator.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info-keywords.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info-subject.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info-title.html
    • /usr/share/doc/php-manual-en/function.pdf-set-info.html
    • /usr/share/doc/php-manual-en/function.pdf-set-layer-dependency.html
    • /usr/share/doc/php-manual-en/function.pdf-set-leading.html
    • /usr/share/doc/php-manual-en/function.pdf-set-parameter.html
    • /usr/share/doc/php-manual-en/function.pdf-set-text-matrix.html
    • /usr/share/doc/php-manual-en/function.pdf-set-text-pos.html
    • /usr/share/doc/php-manual-en/function.pdf-set-text-rendering.html
    • /usr/share/doc/php-manual-en/function.pdf-set-text-rise.html
    • /usr/share/doc/php-manual-en/function.pdf-set-value.html
    • /usr/share/doc/php-manual-en/function.pdf-set-word-spacing.html
    • /usr/share/doc/php-manual-en/function.pdf-setcolor.html
    • /usr/share/doc/php-manual-en/function.pdf-setdash.html
    • /usr/share/doc/php-manual-en/function.pdf-setdashpattern.html
    • /usr/share/doc/php-manual-en/function.pdf-setflat.html
    • /usr/share/doc/php-manual-en/function.pdf-setfont.html
    • /usr/share/doc/php-manual-en/function.pdf-setgray-fill.html
    • /usr/share/doc/php-manual-en/function.pdf-setgray-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-setgray.html
    • /usr/share/doc/php-manual-en/function.pdf-setlinecap.html
    • /usr/share/doc/php-manual-en/function.pdf-setlinejoin.html
    • /usr/share/doc/php-manual-en/function.pdf-setlinewidth.html
    • /usr/share/doc/php-manual-en/function.pdf-setmatrix.html
    • /usr/share/doc/php-manual-en/function.pdf-setmiterlimit.html
    • /usr/share/doc/php-manual-en/function.pdf-setpolydash.html
    • /usr/share/doc/php-manual-en/function.pdf-setrgbcolor-fill.html
    • /usr/share/doc/php-manual-en/function.pdf-setrgbcolor-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-setrgbcolor.html
    • /usr/share/doc/php-manual-en/function.pdf-shading-pattern.html
    • /usr/share/doc/php-manual-en/function.pdf-shading.html
    • /usr/share/doc/php-manual-en/function.pdf-shfill.html
    • /usr/share/doc/php-manual-en/function.pdf-show-boxed.html
    • /usr/share/doc/php-manual-en/function.pdf-show-xy.html
    • /usr/share/doc/php-manual-en/function.pdf-show.html
    • /usr/share/doc/php-manual-en/function.pdf-skew.html
    • /usr/share/doc/php-manual-en/function.pdf-stringwidth.html
    • /usr/share/doc/php-manual-en/function.pdf-stroke.html
    • /usr/share/doc/php-manual-en/function.pdf-suspend-page.html
    • /usr/share/doc/php-manual-en/function.pdf-translate.html
    • /usr/share/doc/php-manual-en/function.pdf-utf16-to-utf8.html
    • /usr/share/doc/php-manual-en/function.pdf-utf32-to-utf16.html
    • /usr/share/doc/php-manual-en/function.pdf-utf8-to-utf16.html
    • /usr/share/doc/php-manual-en/function.pfsockopen.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.php-check-syntax.html
    • /usr/share/doc/php-manual-en/function.php-ini-loaded-file.html
    • /usr/share/doc/php-manual-en/function.php-ini-scanned-files.html
    • /usr/share/doc/php-manual-en/function.php-logo-guid.html
    • /usr/share/doc/php-manual-en/function.php-sapi-name.html
    • /usr/share/doc/php-manual-en/function.php-strip-whitespace.html
    • /usr/share/doc/php-manual-en/function.php-uname.html
    • /usr/share/doc/php-manual-en/function.phpcredits.html
    • /usr/share/doc/php-manual-en/function.phpinfo.html
    • /usr/share/doc/php-manual-en/function.phpversion.html
    • /usr/share/doc/php-manual-en/function.pi.html
    • /usr/share/doc/php-manual-en/function.png2wbmp.html
    • /usr/share/doc/php-manual-en/function.popen.html
    • /usr/share/doc/php-manual-en/function.pos.html
    • /usr/share/doc/php-manual-en/function.posix-access.html
    • /usr/share/doc/php-manual-en/function.posix-ctermid.html
    • /usr/share/doc/php-manual-en/function.posix-errno.html
    • /usr/share/doc/php-manual-en/function.posix-get-last-error.html
    • /usr/share/doc/php-manual-en/function.posix-getcwd.html
    • /usr/share/doc/php-manual-en/function.posix-getegid.html
    • /usr/share/doc/php-manual-en/function.posix-geteuid.html
    • /usr/share/doc/php-manual-en/function.posix-getgid.html
    • /usr/share/doc/php-manual-en/function.posix-getgrgid.html
    • /usr/share/doc/php-manual-en/function.posix-getgrnam.html
    • /usr/share/doc/php-manual-en/function.posix-getgroups.html
    • /usr/share/doc/php-manual-en/function.posix-getlogin.html
    • /usr/share/doc/php-manual-en/function.posix-getpgid.html
    • /usr/share/doc/php-manual-en/function.posix-getpgrp.html
    • /usr/share/doc/php-manual-en/function.posix-getpid.html
    • /usr/share/doc/php-manual-en/function.posix-getppid.html
    • /usr/share/doc/php-manual-en/function.posix-getpwnam.html
    • /usr/share/doc/php-manual-en/function.posix-getpwuid.html
    • /usr/share/doc/php-manual-en/function.posix-getrlimit.html
    • /usr/share/doc/php-manual-en/function.posix-getsid.html
    • /usr/share/doc/php-manual-en/function.posix-getuid.html
    • /usr/share/doc/php-manual-en/function.posix-initgroups.html
    • /usr/share/doc/php-manual-en/function.posix-isatty.html
    • /usr/share/doc/php-manual-en/function.posix-kill.html
    • /usr/share/doc/php-manual-en/function.posix-mkfifo.html
    • /usr/share/doc/php-manual-en/function.posix-mknod.html
    • /usr/share/doc/php-manual-en/function.posix-setegid.html
    • /usr/share/doc/php-manual-en/function.posix-seteuid.html
    • /usr/share/doc/php-manual-en/function.posix-setgid.html
    • /usr/share/doc/php-manual-en/function.posix-setpgid.html
    • /usr/share/doc/php-manual-en/function.posix-setsid.html
    • /usr/share/doc/php-manual-en/function.posix-setuid.html
    • /usr/share/doc/php-manual-en/function.posix-strerror.html
    • /usr/share/doc/php-manual-en/function.posix-times.html
    • /usr/share/doc/php-manual-en/function.posix-ttyname.html
    • /usr/share/doc/php-manual-en/function.posix-uname.html
    • /usr/share/doc/php-manual-en/function.pow.html
    • /usr/share/doc/php-manual-en/function.preg-filter.html
    • /usr/share/doc/php-manual-en/function.preg-grep.html
    • /usr/share/doc/php-manual-en/function.preg-last-error.html
    • /usr/share/doc/php-manual-en/function.preg-match-all.html
    • /usr/share/doc/php-manual-en/function.preg-match.html
    • /usr/share/doc/php-manual-en/function.preg-quote.html
    • /usr/share/doc/php-manual-en/function.preg-replace-callback.html
    • /usr/share/doc/php-manual-en/function.preg-replace.html
    • /usr/share/doc/php-manual-en/function.preg-split.html
    • /usr/share/doc/php-manual-en/function.prev.html
    • /usr/share/doc/php-manual-en/function.print-r.html
    • /usr/share/doc/php-manual-en/function.print.html
    • /usr/share/doc/php-manual-en/function.printer-abort.html
    • /usr/share/doc/php-manual-en/function.printer-close.html
    • /usr/share/doc/php-manual-en/function.printer-create-brush.html
    • /usr/share/doc/php-manual-en/function.printer-create-dc.html
    • /usr/share/doc/php-manual-en/function.printer-create-font.html
    • /usr/share/doc/php-manual-en/function.printer-create-pen.html
    • /usr/share/doc/php-manual-en/function.printer-delete-brush.html
    • /usr/share/doc/php-manual-en/function.printer-delete-dc.html
    • /usr/share/doc/php-manual-en/function.printer-delete-font.html
    • /usr/share/doc/php-manual-en/function.printer-delete-pen.html
    • /usr/share/doc/php-manual-en/function.printer-draw-bmp.html
    • /usr/share/doc/php-manual-en/function.printer-draw-chord.html
    • /usr/share/doc/php-manual-en/function.printer-draw-elipse.html
    • /usr/share/doc/php-manual-en/function.printer-draw-line.html
    • /usr/share/doc/php-manual-en/function.printer-draw-pie.html
    • /usr/share/doc/php-manual-en/function.printer-draw-rectangle.html
    • /usr/share/doc/php-manual-en/function.printer-draw-roundrect.html
    • /usr/share/doc/php-manual-en/function.printer-draw-text.html
    • /usr/share/doc/php-manual-en/function.printer-end-doc.html
    • /usr/share/doc/php-manual-en/function.printer-end-page.html
    • /usr/share/doc/php-manual-en/function.printer-get-option.html
    • /usr/share/doc/php-manual-en/function.printer-list.html
    • /usr/share/doc/php-manual-en/function.printer-logical-fontheight.html
    • /usr/share/doc/php-manual-en/function.printer-open.html
    • /usr/share/doc/php-manual-en/function.printer-select-brush.html
    • /usr/share/doc/php-manual-en/function.printer-select-font.html
    • /usr/share/doc/php-manual-en/function.printer-select-pen.html
    • /usr/share/doc/php-manual-en/function.printer-set-option.html
    • /usr/share/doc/php-manual-en/function.printer-start-doc.html
    • /usr/share/doc/php-manual-en/function.printer-start-page.html
    • /usr/share/doc/php-manual-en/function.printer-write.html
    • /usr/share/doc/php-manual-en/function.printf.html
    • /usr/share/doc/php-manual-en/function.proc-close.html
    • /usr/share/doc/php-manual-en/function.proc-get-status.html
    • /usr/share/doc/php-manual-en/function.proc-nice.html
    • /usr/share/doc/php-manual-en/function.proc-open.html
    • /usr/share/doc/php-manual-en/function.proc-terminate.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.pspell-add-to-personal.html
    • /usr/share/doc/php-manual-en/function.pspell-add-to-session.html
    • /usr/share/doc/php-manual-en/function.pspell-check.html
    • /usr/share/doc/php-manual-en/function.pspell-clear-session.html
    • /usr/share/doc/php-manual-en/function.pspell-config-create.html
    • /usr/share/doc/php-manual-en/function.pspell-config-data-dir.html
    • /usr/share/doc/php-manual-en/function.pspell-config-dict-dir.html
    • /usr/share/doc/php-manual-en/function.pspell-config-ignore.html
    • /usr/share/doc/php-manual-en/function.pspell-config-mode.html
    • /usr/share/doc/php-manual-en/function.pspell-config-personal.html
    • /usr/share/doc/php-manual-en/function.pspell-config-repl.html
    • /usr/share/doc/php-manual-en/function.pspell-config-runtogether.html
    • /usr/share/doc/php-manual-en/function.pspell-config-save-repl.html
    • /usr/share/doc/php-manual-en/function.pspell-new-config.html
    • /usr/share/doc/php-manual-en/function.pspell-new-personal.html
    • /usr/share/doc/php-manual-en/function.pspell-new.html
    • /usr/share/doc/php-manual-en/function.pspell-save-wordlist.html
    • /usr/share/doc/php-manual-en/function.pspell-store-replacement.html
    • /usr/share/doc/php-manual-en/function.pspell-suggest.html
    • /usr/share/doc/php-manual-en/function.putenv.html
    • /usr/share/doc/php-manual-en/function.px-close.html
    • /usr/share/doc/php-manual-en/function.px-create-fp.html
    • /usr/share/doc/php-manual-en/function.px-date2string.html
    • /usr/share/doc/php-manual-en/function.px-delete-record.html
    • /usr/share/doc/php-manual-en/function.px-delete.html
    • /usr/share/doc/php-manual-en/function.px-get-field.html
    • /usr/share/doc/php-manual-en/function.px-get-info.html
    • /usr/share/doc/php-manual-en/function.px-get-parameter.html
    • /usr/share/doc/php-manual-en/function.px-get-record.html
    • /usr/share/doc/php-manual-en/function.px-get-schema.html
    • /usr/share/doc/php-manual-en/function.px-get-value.html
    • /usr/share/doc/php-manual-en/function.px-insert-record.html
    • /usr/share/doc/php-manual-en/function.px-new.html
    • /usr/share/doc/php-manual-en/function.px-numfields.html
    • /usr/share/doc/php-manual-en/function.px-numrecords.html
    • /usr/share/doc/php-manual-en/function.px-open-fp.html
    • /usr/share/doc/php-manual-en/function.px-put-record.html
    • /usr/share/doc/php-manual-en/function.px-retrieve-record.html
    • /usr/share/doc/php-manual-en/function.px-set-blob-file.html
    • /usr/share/doc/php-manual-en/function.px-set-parameter.html
    • /usr/share/doc/php-manual-en/function.px-set-tablename.html
    • /usr/share/doc/php-manual-en/function.px-set-targetencoding.html
    • /usr/share/doc/php-manual-en/function.px-set-value.html
    • /usr/share/doc/php-manual-en/function.px-timestamp2string.html
    • /usr/share/doc/php-manual-en/function.px-update-record.html
    • /usr/share/doc/php-manual-en/function.qdom-error.html
    • /usr/share/doc/php-manual-en/function.qdom-tree.html
    • /usr/share/doc/php-manual-en/function.quoted-printable-decode.html
    • /usr/share/doc/php-manual-en/function.quoted-printable-encode.html
    • /usr/share/doc/php-manual-en/function.quotemeta.html
    • /usr/share/doc/php-manual-en/function.rad2deg.html
    • /usr/share/doc/php-manual-en/function.radius-acct-open.html
    • /usr/share/doc/php-manual-en/function.radius-add-server.html
    • /usr/share/doc/php-manual-en/function.radius-auth-open.html
    • /usr/share/doc/php-manual-en/function.radius-close.html
    • /usr/share/doc/php-manual-en/function.radius-config.html
    • /usr/share/doc/php-manual-en/function.radius-create-request.html
    • /usr/share/doc/php-manual-en/function.radius-cvt-addr.html
    • /usr/share/doc/php-manual-en/function.radius-cvt-int.html
    • /usr/share/doc/php-manual-en/function.radius-cvt-string.html
    • /usr/share/doc/php-manual-en/function.radius-demangle-mppe-key.html
    • /usr/share/doc/php-manual-en/function.radius-demangle.html
    • /usr/share/doc/php-manual-en/function.radius-get-attr.html
    • /usr/share/doc/php-manual-en/function.radius-get-tagged-attr-data.html
    • /usr/share/doc/php-manual-en/function.radius-get-tagged-attr-tag.html
    • /usr/share/doc/php-manual-en/function.radius-get-vendor-attr.html
    • /usr/share/doc/php-manual-en/function.radius-put-addr.html
    • /usr/share/doc/php-manual-en/function.radius-put-attr.html
    • /usr/share/doc/php-manual-en/function.radius-put-int.html
    • /usr/share/doc/php-manual-en/function.radius-put-string.html
    • /usr/share/doc/php-manual-en/function.radius-put-vendor-addr.html
    • /usr/share/doc/php-manual-en/function.radius-put-vendor-attr.html
    • /usr/share/doc/php-manual-en/function.radius-put-vendor-int.html
    • /usr/share/doc/php-manual-en/function.radius-put-vendor-string.html
    • /usr/share/doc/php-manual-en/function.radius-request-authenticator.html
    • /usr/share/doc/php-manual-en/function.radius-salt-encrypt-attr.html
    • /usr/share/doc/php-manual-en/function.radius-send-request.html
    • /usr/share/doc/php-manual-en/function.radius-server-secret.html
    • /usr/share/doc/php-manual-en/function.radius-strerror.html
    • /usr/share/doc/php-manual-en/function.rand.html
    • /usr/share/doc/php-manual-en/function.range.html
    • /usr/share/doc/php-manual-en/function.rar-wrapper-cache-stats.html
    • /usr/share/doc/php-manual-en/function.rawurldecode.html
    • /usr/share/doc/php-manual-en/function.rawurlencode.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.readdir.html
    • /usr/share/doc/php-manual-en/function.readfile.html
    • /usr/share/doc/php-manual-en/function.readgzfile.html
    • /usr/share/doc/php-manual-en/function.readline-add-history.html
    • /usr/share/doc/php-manual-en/function.readline-callback-handler-install.html
    • /usr/share/doc/php-manual-en/function.readline-callback-handler-remove.html
    • /usr/share/doc/php-manual-en/function.readline-callback-read-char.html
    • /usr/share/doc/php-manual-en/function.readline-clear-history.html
    • /usr/share/doc/php-manual-en/function.readline-completion-function.html
    • /usr/share/doc/php-manual-en/function.readline-info.html
    • /usr/share/doc/php-manual-en/function.readline-list-history.html
    • /usr/share/doc/php-manual-en/function.readline-on-new-line.html
    • /usr/share/doc/php-manual-en/function.readline-read-history.html
    • /usr/share/doc/php-manual-en/function.readline-redisplay.html
    • /usr/share/doc/php-manual-en/function.readline-write-history.html
    • /usr/share/doc/php-manual-en/function.readline.html
    • /usr/share/doc/php-manual-en/function.readlink.html
    • /usr/share/doc/php-manual-en/function.realpath-cache-get.html
    • /usr/share/doc/php-manual-en/function.realpath-cache-size.html
    • /usr/share/doc/php-manual-en/function.realpath.html
    • /usr/share/doc/php-manual-en/function.recode-file.html
    • /usr/share/doc/php-manual-en/function.recode-string.html
    • /usr/share/doc/php-manual-en/function.recode.html
    • /usr/share/doc/php-manual-en/function.register-shutdown-function.html
    • /usr/share/doc/php-manual-en/function.register-tick-function.html
    • /usr/share/doc/php-manual-en/function.rename-function.html
    • /usr/share/doc/php-manual-en/function.rename.html
    • /usr/share/doc/php-manual-en/function.require-once.html
    • /usr/share/doc/php-manual-en/function.require.html
    • /usr/share/doc/php-manual-en/function.reset.html
    • /usr/share/doc/php-manual-en/function.restore-error-handler.html
    • /usr/share/doc/php-manual-en/function.restore-exception-handler.html
    • /usr/share/doc/php-manual-en/function.restore-include-path.html
    • /usr/share/doc/php-manual-en/function.return.html
    • /usr/share/doc/php-manual-en/function.rewind.html
    • /usr/share/doc/php-manual-en/function.rewinddir.html
    • /usr/share/doc/php-manual-en/function.rmdir.html
    • /usr/share/doc/php-manual-en/function.round.html
    • /usr/share/doc/php-manual-en/function.rpm-close.html
    • /usr/share/doc/php-manual-en/function.rpm-get-tag.html
    • /usr/share/doc/php-manual-en/function.rpm-is-valid.html
    • /usr/share/doc/php-manual-en/function.rpm-open.html
    • /usr/share/doc/php-manual-en/function.rpm-version.html
    • /usr/share/doc/php-manual-en/function.rrd-create.html
    • /usr/share/doc/php-manual-en/function.rrd-error.html
    • /usr/share/doc/php-manual-en/function.rrd-fetch.html
    • /usr/share/doc/php-manual-en/function.rrd-first.html
    • /usr/share/doc/php-manual-en/function.rrd-graph.html
    • /usr/share/doc/php-manual-en/function.rrd-info.html
    • /usr/share/doc/php-manual-en/function.rrd-last.html
    • /usr/share/doc/php-manual-en/function.rrd-lastupdate.html
    • /usr/share/doc/php-manual-en/function.rrd-restore.html
    • /usr/share/doc/php-manual-en/function.rrd-tune.html
    • /usr/share/doc/php-manual-en/function.rrd-update.html
    • /usr/share/doc/php-manual-en/function.rrd-version.html
    • /usr/share/doc/php-manual-en/function.rrd-xport.html
    • /usr/share/doc/php-manual-en/function.rsort.html
    • /usr/share/doc/php-manual-en/function.rtrim.html
    • /usr/share/doc/php-manual-en/function.runkit-class-adopt.html
    • /usr/share/doc/php-manual-en/function.runkit-class-emancipate.html
    • /usr/share/doc/php-manual-en/function.runkit-constant-add.html
    • /usr/share/doc/php-manual-en/function.runkit-constant-redefine.html
    • /usr/share/doc/php-manual-en/function.runkit-constant-remove.html
    • /usr/share/doc/php-manual-en/function.runkit-function-add.html
    • /usr/share/doc/php-manual-en/function.runkit-function-copy.html
    • /usr/share/doc/php-manual-en/function.runkit-function-redefine.html
    • /usr/share/doc/php-manual-en/function.runkit-function-remove.html
    • /usr/share/doc/php-manual-en/function.runkit-function-rename.html
    • /usr/share/doc/php-manual-en/function.runkit-import.html
    • /usr/share/doc/php-manual-en/function.runkit-lint-file.html
    • /usr/share/doc/php-manual-en/function.runkit-lint.html
    • /usr/share/doc/php-manual-en/function.runkit-method-add.html
    • /usr/share/doc/php-manual-en/function.runkit-method-copy.html
    • /usr/share/doc/php-manual-en/function.runkit-method-redefine.html
    • /usr/share/doc/php-manual-en/function.runkit-method-remove.html
    • /usr/share/doc/php-manual-en/function.runkit-method-rename.html
    • /usr/share/doc/php-manual-en/function.runkit-return-value-used.html
    • /usr/share/doc/php-manual-en/function.runkit-sandbox-output-handler.html
    • /usr/share/doc/php-manual-en/function.runkit-superglobals.html
    • /usr/share/doc/php-manual-en/function.scandir.html
    • /usr/share/doc/php-manual-en/function.sem-acquire.html
    • /usr/share/doc/php-manual-en/function.sem-get.html
    • /usr/share/doc/php-manual-en/function.sem-release.html
    • /usr/share/doc/php-manual-en/function.sem-remove.html
    • /usr/share/doc/php-manual-en/function.serialize.html
    • /usr/share/doc/php-manual-en/function.session-cache-expire.html
    • /usr/share/doc/php-manual-en/function.session-cache-limiter.html
    • /usr/share/doc/php-manual-en/function.session-commit.html
    • /usr/share/doc/php-manual-en/function.session-decode.html
    • /usr/share/doc/php-manual-en/function.session-destroy.html
    • /usr/share/doc/php-manual-en/function.session-encode.html
    • /usr/share/doc/php-manual-en/function.session-get-cookie-params.html
    • /usr/share/doc/php-manual-en/function.session-id.html
    • /usr/share/doc/php-manual-en/function.session-is-registered.html
    • /usr/share/doc/php-manual-en/function.session-module-name.html
    • /usr/share/doc/php-manual-en/function.session-name.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-add-error.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-get-error.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-get-field.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-reset.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-set-field.html
    • /usr/share/doc/php-manual-en/function.session-pgsql-status.html
    • /usr/share/doc/php-manual-en/function.session-regenerate-id.html
    • /usr/share/doc/php-manual-en/function.session-register-shutdown.html
    • /usr/share/doc/php-manual-en/function.session-register.html
    • /usr/share/doc/php-manual-en/function.session-save-path.html
    • /usr/share/doc/php-manual-en/function.session-set-cookie-params.html
    • /usr/share/doc/php-manual-en/function.session-set-save-handler.html
    • /usr/share/doc/php-manual-en/function.session-start.html
    • /usr/share/doc/php-manual-en/function.session-status.html
    • /usr/share/doc/php-manual-en/function.session-unregister.html
    • /usr/share/doc/php-manual-en/function.session-unset.html
    • /usr/share/doc/php-manual-en/function.session-write-close.html
    • /usr/share/doc/php-manual-en/function.set-error-handler.html
    • /usr/share/doc/php-manual-en/function.set-exception-handler.html
    • /usr/share/doc/php-manual-en/function.set-file-buffer.html
    • /usr/share/doc/php-manual-en/function.set-include-path.html
    • /usr/share/doc/php-manual-en/function.set-magic-quotes-runtime.html
    • /usr/share/doc/php-manual-en/function.set-socket-blocking.html
    • /usr/share/doc/php-manual-en/function.set-time-limit.html
    • /usr/share/doc/php-manual-en/function.setcookie.html
    • /usr/share/doc/php-manual-en/function.setlocale.html
    • /usr/share/doc/php-manual-en/function.setproctitle.html
    • /usr/share/doc/php-manual-en/function.setrawcookie.html
    • /usr/share/doc/php-manual-en/function.setthreadtitle.html
    • /usr/share/doc/php-manual-en/function.settype.html
    • /usr/share/doc/php-manual-en/function.sha1-file.html
    • /usr/share/doc/php-manual-en/function.sha1.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.shm-attach.html
    • /usr/share/doc/php-manual-en/function.shm-detach.html
    • /usr/share/doc/php-manual-en/function.shm-get-var.html
    • /usr/share/doc/php-manual-en/function.shm-has-var.html
    • /usr/share/doc/php-manual-en/function.shm-put-var.html
    • /usr/share/doc/php-manual-en/function.shm-remove-var.html
    • /usr/share/doc/php-manual-en/function.shm-remove.html
    • /usr/share/doc/php-manual-en/function.shmop-close.html
    • /usr/share/doc/php-manual-en/function.shmop-delete.html
    • /usr/share/doc/php-manual-en/function.shmop-open.html
    • /usr/share/doc/php-manual-en/function.shmop-read.html
    • /usr/share/doc/php-manual-en/function.shmop-size.html
    • /usr/share/doc/php-manual-en/function.shmop-write.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.shuffle.html
    • /usr/share/doc/php-manual-en/function.signeurlpaiement.html
    • /usr/share/doc/php-manual-en/function.similar-text.html
    • /usr/share/doc/php-manual-en/function.simplexml-import-dom.html
    • /usr/share/doc/php-manual-en/function.simplexml-load-file.html
    • /usr/share/doc/php-manual-en/function.simplexml-load-string.html
    • /usr/share/doc/php-manual-en/function.sin.html
    • /usr/share/doc/php-manual-en/function.sinh.html
    • /usr/share/doc/php-manual-en/function.sizeof.html
    • /usr/share/doc/php-manual-en/function.sleep.html
    • /usr/share/doc/php-manual-en/function.snmp-get-quick-print.html
    • /usr/share/doc/php-manual-en/function.snmp-get-valueretrieval.html
    • /usr/share/doc/php-manual-en/function.snmp-read-mib.html
    • /usr/share/doc/php-manual-en/function.snmp-set-enum-print.html
    • /usr/share/doc/php-manual-en/function.snmp-set-oid-numeric-print.html
    • /usr/share/doc/php-manual-en/function.snmp-set-oid-output-format.html
    • /usr/share/doc/php-manual-en/function.snmp-set-quick-print.html
    • /usr/share/doc/php-manual-en/function.snmp-set-valueretrieval.html
    • /usr/share/doc/php-manual-en/function.snmp2-get.html
    • /usr/share/doc/php-manual-en/function.snmp2-getnext.html
    • /usr/share/doc/php-manual-en/function.snmp2-real-walk.html
    • /usr/share/doc/php-manual-en/function.snmp2-set.html
    • /usr/share/doc/php-manual-en/function.snmp2-walk.html
    • /usr/share/doc/php-manual-en/function.snmp3-get.html
    • /usr/share/doc/php-manual-en/function.snmp3-getnext.html
    • /usr/share/doc/php-manual-en/function.snmp3-real-walk.html
    • /usr/share/doc/php-manual-en/function.snmp3-set.html
    • /usr/share/doc/php-manual-en/function.snmp3-walk.html
    • /usr/share/doc/php-manual-en/function.snmpget.html
    • /usr/share/doc/php-manual-en/function.snmpgetnext.html
    • /usr/share/doc/php-manual-en/function.snmprealwalk.html
    • /usr/share/doc/php-manual-en/function.snmpset.html
    • /usr/share/doc/php-manual-en/function.snmpwalk.html
    • /usr/share/doc/php-manual-en/function.snmpwalkoid.html
    • /usr/share/doc/php-manual-en/function.socket-accept.html
    • /usr/share/doc/php-manual-en/function.socket-bind.html
    • /usr/share/doc/php-manual-en/function.socket-clear-error.html
    • /usr/share/doc/php-manual-en/function.socket-close.html
    • /usr/share/doc/php-manual-en/function.socket-cmsg-space.html
    • /usr/share/doc/php-manual-en/function.socket-connect.html
    • /usr/share/doc/php-manual-en/function.socket-create-listen.html
    • /usr/share/doc/php-manual-en/function.socket-create-pair.html
    • /usr/share/doc/php-manual-en/function.socket-create.html
    • /usr/share/doc/php-manual-en/function.socket-get-option.html
    • /usr/share/doc/php-manual-en/function.socket-get-status.html
    • /usr/share/doc/php-manual-en/function.socket-getpeername.html
    • /usr/share/doc/php-manual-en/function.socket-getsockname.html
    • /usr/share/doc/php-manual-en/function.socket-import-stream.html
    • /usr/share/doc/php-manual-en/function.socket-last-error.html
    • /usr/share/doc/php-manual-en/function.socket-listen.html
    • /usr/share/doc/php-manual-en/function.socket-read.html
    • /usr/share/doc/php-manual-en/function.socket-recv.html
    • /usr/share/doc/php-manual-en/function.socket-recvfrom.html
    • /usr/share/doc/php-manual-en/function.socket-recvmsg.html
    • /usr/share/doc/php-manual-en/function.socket-select.html
    • /usr/share/doc/php-manual-en/function.socket-send.html
    • /usr/share/doc/php-manual-en/function.socket-sendmsg.html
    • /usr/share/doc/php-manual-en/function.socket-sendto.html
    • /usr/share/doc/php-manual-en/function.socket-set-block.html
    • /usr/share/doc/php-manual-en/function.socket-set-blocking.html
    • /usr/share/doc/php-manual-en/function.socket-set-nonblock.html
    • /usr/share/doc/php-manual-en/function.socket-set-option.html
    • /usr/share/doc/php-manual-en/function.socket-set-timeout.html
    • /usr/share/doc/php-manual-en/function.socket-shutdown.html
    • /usr/share/doc/php-manual-en/function.socket-strerror.html
    • /usr/share/doc/php-manual-en/function.socket-write.html
    • /usr/share/doc/php-manual-en/function.solr-get-version.html
    • /usr/share/doc/php-manual-en/function.sort.html
    • /usr/share/doc/php-manual-en/function.soundex.html
    • /usr/share/doc/php-manual-en/function.spl-autoload-call.html
    • /usr/share/doc/php-manual-en/function.spl-autoload-extensions.html
    • /usr/share/doc/php-manual-en/function.spl-autoload-functions.html
    • /usr/share/doc/php-manual-en/function.spl-autoload-register.html
    • /usr/share/doc/php-manual-en/function.spl-autoload-unregister.html
    • /usr/share/doc/php-manual-en/function.spl-autoload.html
    • /usr/share/doc/php-manual-en/function.spl-classes.html
    • /usr/share/doc/php-manual-en/function.spl-object-hash.html
    • /usr/share/doc/php-manual-en/function.split.html
    • /usr/share/doc/php-manual-en/function.spliti.html
    • /usr/share/doc/php-manual-en/function.sprintf.html
    • /usr/share/doc/php-manual-en/function.sql-regcase.html
    • /usr/share/doc/php-manual-en/function.sqlite-array-query.html
    • /usr/share/doc/php-manual-en/function.sqlite-busy-timeout.html
    • /usr/share/doc/php-manual-en/function.sqlite-changes.html
    • /usr/share/doc/php-manual-en/function.sqlite-close.html
    • /usr/share/doc/php-manual-en/function.sqlite-column.html
    • /usr/share/doc/php-manual-en/function.sqlite-create-aggregate.html
    • /usr/share/doc/php-manual-en/function.sqlite-create-function.html
    • /usr/share/doc/php-manual-en/function.sqlite-current.html
    • /usr/share/doc/php-manual-en/function.sqlite-error-string.html
    • /usr/share/doc/php-manual-en/function.sqlite-escape-string.html
    • /usr/share/doc/php-manual-en/function.sqlite-exec.html
    • /usr/share/doc/php-manual-en/function.sqlite-factory.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-all.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-array.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-column-types.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-object.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-single.html
    • /usr/share/doc/php-manual-en/function.sqlite-fetch-string.html
    • /usr/share/doc/php-manual-en/function.sqlite-field-name.html
    • /usr/share/doc/php-manual-en/function.sqlite-has-more.html
    • /usr/share/doc/php-manual-en/function.sqlite-has-prev.html
    • /usr/share/doc/php-manual-en/function.sqlite-key.html
    • /usr/share/doc/php-manual-en/function.sqlite-last-error.html
    • /usr/share/doc/php-manual-en/function.sqlite-last-insert-rowid.html
    • /usr/share/doc/php-manual-en/function.sqlite-libencoding.html
    • /usr/share/doc/php-manual-en/function.sqlite-libversion.html
    • /usr/share/doc/php-manual-en/function.sqlite-next.html
    • /usr/share/doc/php-manual-en/function.sqlite-num-fields.html
    • /usr/share/doc/php-manual-en/function.sqlite-num-rows.html
    • /usr/share/doc/php-manual-en/function.sqlite-open.html
    • /usr/share/doc/php-manual-en/function.sqlite-popen.html
    • /usr/share/doc/php-manual-en/function.sqlite-prev.html
    • /usr/share/doc/php-manual-en/function.sqlite-query.html
    • /usr/share/doc/php-manual-en/function.sqlite-rewind.html
    • /usr/share/doc/php-manual-en/function.sqlite-seek.html
    • /usr/share/doc/php-manual-en/function.sqlite-single-query.html
    • /usr/share/doc/php-manual-en/function.sqlite-udf-decode-binary.html
    • /usr/share/doc/php-manual-en/function.sqlite-udf-encode-binary.html
    • /usr/share/doc/php-manual-en/function.sqlite-unbuffered-query.html
    • /usr/share/doc/php-manual-en/function.sqlite-valid.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-begin-transaction.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-cancel.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-client-info.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-close.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-commit.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-configure.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-connect.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-errors.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-execute.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-fetch-array.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-fetch-object.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-fetch.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-field-metadata.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-free-stmt.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-get-config.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-get-field.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-has-rows.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-next-result.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-num-fields.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-num-rows.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-prepare.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-query.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-rollback.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-rows-affected.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-send-stream-data.html
    • /usr/share/doc/php-manual-en/function.sqlsrv-server-info.html
    • /usr/share/doc/php-manual-en/function.sqrt.html
    • /usr/share/doc/php-manual-en/function.srand.html
    • /usr/share/doc/php-manual-en/function.sscanf.html
    • /usr/share/doc/php-manual-en/function.ssdeep-fuzzy-compare.html
    • /usr/share/doc/php-manual-en/function.ssdeep-fuzzy-hash-filename.html
    • /usr/share/doc/php-manual-en/function.ssdeep-fuzzy-hash.html
    • /usr/share/doc/php-manual-en/function.ssh2-auth-agent.html
    • /usr/share/doc/php-manual-en/function.ssh2-auth-hostbased-file.html
    • /usr/share/doc/php-manual-en/function.ssh2-auth-none.html
    • /usr/share/doc/php-manual-en/function.ssh2-auth-password.html
    • /usr/share/doc/php-manual-en/function.ssh2-auth-pubkey-file.html
    • /usr/share/doc/php-manual-en/function.ssh2-connect.html
    • /usr/share/doc/php-manual-en/function.ssh2-exec.html
    • /usr/share/doc/php-manual-en/function.ssh2-fetch-stream.html
    • /usr/share/doc/php-manual-en/function.ssh2-fingerprint.html
    • /usr/share/doc/php-manual-en/function.ssh2-methods-negotiated.html
    • /usr/share/doc/php-manual-en/function.ssh2-publickey-add.html
    • /usr/share/doc/php-manual-en/function.ssh2-publickey-init.html
    • /usr/share/doc/php-manual-en/function.ssh2-publickey-list.html
    • /usr/share/doc/php-manual-en/function.ssh2-publickey-remove.html
    • /usr/share/doc/php-manual-en/function.ssh2-scp-recv.html
    • /usr/share/doc/php-manual-en/function.ssh2-scp-send.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-chmod.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-lstat.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-mkdir.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-readlink.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-realpath.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-rename.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-rmdir.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-stat.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-symlink.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp-unlink.html
    • /usr/share/doc/php-manual-en/function.ssh2-sftp.html
    • /usr/share/doc/php-manual-en/function.ssh2-shell.html
    • /usr/share/doc/php-manual-en/function.ssh2-tunnel.html
    • /usr/share/doc/php-manual-en/function.stat.html
    • /usr/share/doc/php-manual-en/function.stats-absolute-deviation.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-beta.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-binomial.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-cauchy.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-chisquare.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-exponential.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-f.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-gamma.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-laplace.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-logistic.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-negative-binomial.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-noncentral-chisquare.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-noncentral-f.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-poisson.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-t.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-uniform.html
    • /usr/share/doc/php-manual-en/function.stats-cdf-weibull.html
    • /usr/share/doc/php-manual-en/function.stats-covariance.html
    • /usr/share/doc/php-manual-en/function.stats-den-uniform.html
    • /usr/share/doc/php-manual-en/function.stats-dens-beta.html
    • /usr/share/doc/php-manual-en/function.stats-dens-cauchy.html
    • /usr/share/doc/php-manual-en/function.stats-dens-chisquare.html
    • /usr/share/doc/php-manual-en/function.stats-dens-exponential.html
    • /usr/share/doc/php-manual-en/function.stats-dens-f.html
    • /usr/share/doc/php-manual-en/function.stats-dens-gamma.html
    • /usr/share/doc/php-manual-en/function.stats-dens-laplace.html
    • /usr/share/doc/php-manual-en/function.stats-dens-logistic.html
    • /usr/share/doc/php-manual-en/function.stats-dens-negative-binomial.html
    • /usr/share/doc/php-manual-en/function.stats-dens-normal.html
    • /usr/share/doc/php-manual-en/function.stats-dens-pmf-binomial.html
    • /usr/share/doc/php-manual-en/function.stats-dens-pmf-hypergeometric.html
    • /usr/share/doc/php-manual-en/function.stats-dens-pmf-poisson.html
    • /usr/share/doc/php-manual-en/function.stats-dens-t.html
    • /usr/share/doc/php-manual-en/function.stats-dens-weibull.html
    • /usr/share/doc/php-manual-en/function.stats-harmonic-mean.html
    • /usr/share/doc/php-manual-en/function.stats-kurtosis.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-beta.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-chisquare.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-exponential.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-f.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-funiform.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-gamma.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-ibinomial-negative.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-ibinomial.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-int.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-ipoisson.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-iuniform.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-noncenral-chisquare.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-noncentral-f.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-noncentral-t.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-normal.html
    • /usr/share/doc/php-manual-en/function.stats-rand-gen-t.html
    • /usr/share/doc/php-manual-en/function.stats-rand-get-seeds.html
    • /usr/share/doc/php-manual-en/function.stats-rand-phrase-to-seeds.html
    • /usr/share/doc/php-manual-en/function.stats-rand-ranf.html
    • /usr/share/doc/php-manual-en/function.stats-rand-setall.html
    • /usr/share/doc/php-manual-en/function.stats-skew.html
    • /usr/share/doc/php-manual-en/function.stats-standard-deviation.html
    • /usr/share/doc/php-manual-en/function.stats-stat-binomial-coef.html
    • /usr/share/doc/php-manual-en/function.stats-stat-correlation.html
    • /usr/share/doc/php-manual-en/function.stats-stat-gennch.html
    • /usr/share/doc/php-manual-en/function.stats-stat-independent-t.html
    • /usr/share/doc/php-manual-en/function.stats-stat-innerproduct.html
    • /usr/share/doc/php-manual-en/function.stats-stat-noncentral-t.html
    • /usr/share/doc/php-manual-en/function.stats-stat-paired-t.html
    • /usr/share/doc/php-manual-en/function.stats-stat-percentile.html
    • /usr/share/doc/php-manual-en/function.stats-stat-powersum.html
    • /usr/share/doc/php-manual-en/function.stats-variance.html
    • /usr/share/doc/php-manual-en/function.stomp-connect-error.html
    • /usr/share/doc/php-manual-en/function.stomp-version.html
    • /usr/share/doc/php-manual-en/function.str-getcsv.html
    • /usr/share/doc/php-manual-en/function.str-ireplace.html
    • /usr/share/doc/php-manual-en/function.str-pad.html
    • /usr/share/doc/php-manual-en/function.str-repeat.html
    • /usr/share/doc/php-manual-en/function.str-replace.html
    • /usr/share/doc/php-manual-en/function.str-rot13.html
    • /usr/share/doc/php-manual-en/function.str-shuffle.html
    • /usr/share/doc/php-manual-en/function.str-split.html
    • /usr/share/doc/php-manual-en/function.str-word-count.html
    • /usr/share/doc/php-manual-en/function.strcasecmp.html
    • /usr/share/doc/php-manual-en/function.strchr.html
    • /usr/share/doc/php-manual-en/function.strcmp.html
    • /usr/share/doc/php-manual-en/function.strcoll.html
    • /usr/share/doc/php-manual-en/function.strcspn.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.strftime.html
    • /usr/share/doc/php-manual-en/function.strip-tags.html
    • /usr/share/doc/php-manual-en/function.stripcslashes.html
    • /usr/share/doc/php-manual-en/function.stripos.html
    • /usr/share/doc/php-manual-en/function.stripslashes.html
    • /usr/share/doc/php-manual-en/function.stristr.html
    • /usr/share/doc/php-manual-en/function.strlen.html
    • /usr/share/doc/php-manual-en/function.strnatcasecmp.html
    • /usr/share/doc/php-manual-en/function.strnatcmp.html
    • /usr/share/doc/php-manual-en/function.strncasecmp.html
    • /usr/share/doc/php-manual-en/function.strncmp.html
    • /usr/share/doc/php-manual-en/function.strpbrk.html
    • /usr/share/doc/php-manual-en/function.strpos.html
    • /usr/share/doc/php-manual-en/function.strptime.html
    • /usr/share/doc/php-manual-en/function.strrchr.html
    • /usr/share/doc/php-manual-en/function.strrev.html
    • /usr/share/doc/php-manual-en/function.strripos.html
    • /usr/share/doc/php-manual-en/function.strrpos.html
    • /usr/share/doc/php-manual-en/function.strspn.html
    • /usr/share/doc/php-manual-en/function.strstr.html
    • /usr/share/doc/php-manual-en/function.strtok.html
    • /usr/share/doc/php-manual-en/function.strtolower.html
    • /usr/share/doc/php-manual-en/function.strtotime.html
    • /usr/share/doc/php-manual-en/function.strtoupper.html
    • /usr/share/doc/php-manual-en/function.strtr.html
    • /usr/share/doc/php-manual-en/function.strval.html
    • /usr/share/doc/php-manual-en/function.substr-compare.html
    • /usr/share/doc/php-manual-en/function.substr-count.html
    • /usr/share/doc/php-manual-en/function.substr-replace.html
    • /usr/share/doc/php-manual-en/function.substr.html
    • /usr/share/doc/php-manual-en/function.svn-add.html
    • /usr/share/doc/php-manual-en/function.svn-auth-get-parameter.html
    • /usr/share/doc/php-manual-en/function.svn-auth-set-parameter.html
    • /usr/share/doc/php-manual-en/function.svn-blame.html
    • /usr/share/doc/php-manual-en/function.svn-cat.html
    • /usr/share/doc/php-manual-en/function.svn-checkout.html
    • /usr/share/doc/php-manual-en/function.svn-cleanup.html
    • /usr/share/doc/php-manual-en/function.svn-client-version.html
    • /usr/share/doc/php-manual-en/function.svn-commit.html
    • /usr/share/doc/php-manual-en/function.svn-delete.html
    • /usr/share/doc/php-manual-en/function.svn-diff.html
    • /usr/share/doc/php-manual-en/function.svn-export.html
    • /usr/share/doc/php-manual-en/function.svn-fs-abort-txn.html
    • /usr/share/doc/php-manual-en/function.svn-fs-apply-text.html
    • /usr/share/doc/php-manual-en/function.svn-fs-begin-txn2.html
    • /usr/share/doc/php-manual-en/function.svn-fs-change-node-prop.html
    • /usr/share/doc/php-manual-en/function.svn-fs-check-path.html
    • /usr/share/doc/php-manual-en/function.svn-fs-contents-changed.html
    • /usr/share/doc/php-manual-en/function.svn-fs-copy.html
    • /usr/share/doc/php-manual-en/function.svn-fs-delete.html
    • /usr/share/doc/php-manual-en/function.svn-fs-dir-entries.html
    • /usr/share/doc/php-manual-en/function.svn-fs-file-contents.html
    • /usr/share/doc/php-manual-en/function.svn-fs-file-length.html
    • /usr/share/doc/php-manual-en/function.svn-fs-is-dir.html
    • /usr/share/doc/php-manual-en/function.svn-fs-is-file.html
    • /usr/share/doc/php-manual-en/function.svn-fs-make-dir.html
    • /usr/share/doc/php-manual-en/function.svn-fs-make-file.html
    • /usr/share/doc/php-manual-en/function.svn-fs-node-created-rev.html
    • /usr/share/doc/php-manual-en/function.svn-fs-node-prop.html
    • /usr/share/doc/php-manual-en/function.svn-fs-props-changed.html
    • /usr/share/doc/php-manual-en/function.svn-fs-revision-prop.html
    • /usr/share/doc/php-manual-en/function.svn-fs-revision-root.html
    • /usr/share/doc/php-manual-en/function.svn-fs-txn-root.html
    • /usr/share/doc/php-manual-en/function.svn-fs-youngest-rev.html
    • /usr/share/doc/php-manual-en/function.svn-import.html
    • /usr/share/doc/php-manual-en/function.svn-log.html
    • /usr/share/doc/php-manual-en/function.svn-ls.html
    • /usr/share/doc/php-manual-en/function.svn-mkdir.html
    • /usr/share/doc/php-manual-en/function.svn-repos-create.html
    • /usr/share/doc/php-manual-en/function.svn-repos-fs-begin-txn-for-commit.html
    • /usr/share/doc/php-manual-en/function.svn-repos-fs-commit-txn.html
    • /usr/share/doc/php-manual-en/function.svn-repos-fs.html
    • /usr/share/doc/php-manual-en/function.svn-repos-hotcopy.html
    • /usr/share/doc/php-manual-en/function.svn-repos-open.html
    • /usr/share/doc/php-manual-en/function.svn-repos-recover.html
    • /usr/share/doc/php-manual-en/function.svn-revert.html
    • /usr/share/doc/php-manual-en/function.svn-status.html
    • /usr/share/doc/php-manual-en/function.svn-update.html
    • /usr/share/doc/php-manual-en/function.swf-actiongeturl.html
    • /usr/share/doc/php-manual-en/function.swf-actiongotoframe.html
    • /usr/share/doc/php-manual-en/function.swf-actiongotolabel.html
    • /usr/share/doc/php-manual-en/function.swf-actionnextframe.html
    • /usr/share/doc/php-manual-en/function.swf-actionplay.html
    • /usr/share/doc/php-manual-en/function.swf-actionprevframe.html
    • /usr/share/doc/php-manual-en/function.swf-actionsettarget.html
    • /usr/share/doc/php-manual-en/function.swf-actionstop.html
    • /usr/share/doc/php-manual-en/function.swf-actiontogglequality.html
    • /usr/share/doc/php-manual-en/function.swf-actionwaitforframe.html
    • /usr/share/doc/php-manual-en/function.swf-addbuttonrecord.html
    • /usr/share/doc/php-manual-en/function.swf-addcolor.html
    • /usr/share/doc/php-manual-en/function.swf-closefile.html
    • /usr/share/doc/php-manual-en/function.swf-definebitmap.html
    • /usr/share/doc/php-manual-en/function.swf-definefont.html
    • /usr/share/doc/php-manual-en/function.swf-defineline.html
    • /usr/share/doc/php-manual-en/function.swf-definepoly.html
    • /usr/share/doc/php-manual-en/function.swf-definerect.html
    • /usr/share/doc/php-manual-en/function.swf-definetext.html
    • /usr/share/doc/php-manual-en/function.swf-endbutton.html
    • /usr/share/doc/php-manual-en/function.swf-enddoaction.html
    • /usr/share/doc/php-manual-en/function.swf-endshape.html
    • /usr/share/doc/php-manual-en/function.swf-endsymbol.html
    • /usr/share/doc/php-manual-en/function.swf-fontsize.html
    • /usr/share/doc/php-manual-en/function.swf-fontslant.html
    • /usr/share/doc/php-manual-en/function.swf-fonttracking.html
    • /usr/share/doc/php-manual-en/function.swf-getbitmapinfo.html
    • /usr/share/doc/php-manual-en/function.swf-getfontinfo.html
    • /usr/share/doc/php-manual-en/function.swf-getframe.html
    • /usr/share/doc/php-manual-en/function.swf-labelframe.html
    • /usr/share/doc/php-manual-en/function.swf-lookat.html
    • /usr/share/doc/php-manual-en/function.swf-modifyobject.html
    • /usr/share/doc/php-manual-en/function.swf-mulcolor.html
    • /usr/share/doc/php-manual-en/function.swf-nextid.html
    • /usr/share/doc/php-manual-en/function.swf-oncondition.html
    • /usr/share/doc/php-manual-en/function.swf-openfile.html
    • /usr/share/doc/php-manual-en/function.swf-ortho.html
    • /usr/share/doc/php-manual-en/function.swf-ortho2.html
    • /usr/share/doc/php-manual-en/function.swf-perspective.html
    • /usr/share/doc/php-manual-en/function.swf-placeobject.html
    • /usr/share/doc/php-manual-en/function.swf-polarview.html
    • /usr/share/doc/php-manual-en/function.swf-popmatrix.html
    • /usr/share/doc/php-manual-en/function.swf-posround.html
    • /usr/share/doc/php-manual-en/function.swf-pushmatrix.html
    • /usr/share/doc/php-manual-en/function.swf-removeobject.html
    • /usr/share/doc/php-manual-en/function.swf-rotate.html
    • /usr/share/doc/php-manual-en/function.swf-scale.html
    • /usr/share/doc/php-manual-en/function.swf-setfont.html
    • /usr/share/doc/php-manual-en/function.swf-setframe.html
    • /usr/share/doc/php-manual-en/function.swf-shapearc.html
    • /usr/share/doc/php-manual-en/function.swf-shapecurveto.html
    • /usr/share/doc/php-manual-en/function.swf-shapecurveto3.html
    • /usr/share/doc/php-manual-en/function.swf-shapefillbitmapclip.html
    • /usr/share/doc/php-manual-en/function.swf-shapefillbitmaptile.html
    • /usr/share/doc/php-manual-en/function.swf-shapefilloff.html
    • /usr/share/doc/php-manual-en/function.swf-shapefillsolid.html
    • /usr/share/doc/php-manual-en/function.swf-shapelinesolid.html
    • /usr/share/doc/php-manual-en/function.swf-shapelineto.html
    • /usr/share/doc/php-manual-en/function.swf-shapemoveto.html
    • /usr/share/doc/php-manual-en/function.swf-showframe.html
    • /usr/share/doc/php-manual-en/function.swf-startbutton.html
    • /usr/share/doc/php-manual-en/function.swf-startdoaction.html
    • /usr/share/doc/php-manual-en/function.swf-startshape.html
    • /usr/share/doc/php-manual-en/function.swf-startsymbol.html
    • /usr/share/doc/php-manual-en/function.swf-textwidth.html
    • /usr/share/doc/php-manual-en/function.swf-translate.html
    • /usr/share/doc/php-manual-en/function.swf-viewport.html
    • /usr/share/doc/php-manual-en/function.sybase-affected-rows.html
    • /usr/share/doc/php-manual-en/function.sybase-close.html
    • /usr/share/doc/php-manual-en/function.sybase-connect.html
    • /usr/share/doc/php-manual-en/function.sybase-data-seek.html
    • /usr/share/doc/php-manual-en/function.sybase-deadlock-retry-count.html
    • /usr/share/doc/php-manual-en/function.sybase-fetch-array.html
    • /usr/share/doc/php-manual-en/function.sybase-fetch-assoc.html
    • /usr/share/doc/php-manual-en/function.sybase-fetch-field.html
    • /usr/share/doc/php-manual-en/function.sybase-fetch-object.html
    • /usr/share/doc/php-manual-en/function.sybase-fetch-row.html
    • /usr/share/doc/php-manual-en/function.sybase-field-seek.html
    • /usr/share/doc/php-manual-en/function.sybase-free-result.html
    • /usr/share/doc/php-manual-en/function.sybase-get-last-message.html
    • /usr/share/doc/php-manual-en/function.sybase-min-client-severity.html
    • /usr/share/doc/php-manual-en/function.sybase-min-error-severity.html
    • /usr/share/doc/php-manual-en/function.sybase-min-message-severity.html
    • /usr/share/doc/php-manual-en/function.sybase-min-server-severity.html
    • /usr/share/doc/php-manual-en/function.sybase-num-fields.html
    • /usr/share/doc/php-manual-en/function.sybase-num-rows.html
    • /usr/share/doc/php-manual-en/function.sybase-pconnect.html
    • /usr/share/doc/php-manual-en/function.sybase-query.html
    • /usr/share/doc/php-manual-en/function.sybase-result.html
    • /usr/share/doc/php-manual-en/function.sybase-select-db.html
    • /usr/share/doc/php-manual-en/function.sybase-set-message-handler.html
    • /usr/share/doc/php-manual-en/function.sybase-unbuffered-query.html
    • /usr/share/doc/php-manual-en/function.symlink.html
    • /usr/share/doc/php-manual-en/function.sys-get-temp-dir.html
    • /usr/share/doc/php-manual-en/function.sys-getloadavg.html
    • /usr/share/doc/php-manual-en/function.syslog.html
    • /usr/share/doc/php-manual-en/function.system.html
    • /usr/share/doc/php-manual-en/function.taint.html
    • /usr/share/doc/php-manual-en/function.tan.html
    • /usr/share/doc/php-manual-en/function.tanh.html
    • /usr/share/doc/php-manual-en/function.tcpwrap-check.html
    • /usr/share/doc/php-manual-en/function.tempnam.html
    • /usr/share/doc/php-manual-en/function.textdomain.html
    • /usr/share/doc/php-manual-en/function.tidy-access-count.html
    • /usr/share/doc/php-manual-en/function.tidy-config-count.html
    • /usr/share/doc/php-manual-en/function.tidy-error-count.html
    • /usr/share/doc/php-manual-en/function.tidy-get-output.html
    • /usr/share/doc/php-manual-en/function.tidy-load-config.html
    • /usr/share/doc/php-manual-en/function.tidy-reset-config.html
    • /usr/share/doc/php-manual-en/function.tidy-save-config.html
    • /usr/share/doc/php-manual-en/function.tidy-set-encoding.html
    • /usr/share/doc/php-manual-en/function.tidy-setopt.html
    • /usr/share/doc/php-manual-en/function.tidy-warning-count.html
    • /usr/share/doc/php-manual-en/function.time-nanosleep.html
    • /usr/share/doc/php-manual-en/function.time-sleep-until.html
    • /usr/share/doc/php-manual-en/function.time.html
    • /usr/share/doc/php-manual-en/function.timezone-abbreviations-list.html
    • /usr/share/doc/php-manual-en/function.timezone-identifiers-list.html
    • /usr/share/doc/php-manual-en/function.timezone-location-get.html
    • /usr/share/doc/php-manual-en/function.timezone-name-from-abbr.html
    • /usr/share/doc/php-manual-en/function.timezone-name-get.html
    • /usr/share/doc/php-manual-en/function.timezone-offset-get.html
    • /usr/share/doc/php-manual-en/function.timezone-open.html
    • /usr/share/doc/php-manual-en/function.timezone-transitions-get.html
    • /usr/share/doc/php-manual-en/function.timezone-version-get.html
    • /usr/share/doc/php-manual-en/function.tmpfile.html
    • /usr/share/doc/php-manual-en/function.token-get-all.html
    • /usr/share/doc/php-manual-en/function.token-name.html
    • /usr/share/doc/php-manual-en/function.touch.html
    • /usr/share/doc/php-manual-en/function.trader-acos.html
    • /usr/share/doc/php-manual-en/function.trader-ad.html
    • /usr/share/doc/php-manual-en/function.trader-add.html
    • /usr/share/doc/php-manual-en/function.trader-adosc.html
    • /usr/share/doc/php-manual-en/function.trader-adx.html
    • /usr/share/doc/php-manual-en/function.trader-adxr.html
    • /usr/share/doc/php-manual-en/function.trader-apo.html
    • /usr/share/doc/php-manual-en/function.trader-aroon.html
    • /usr/share/doc/php-manual-en/function.trader-aroonosc.html
    • /usr/share/doc/php-manual-en/function.trader-asin.html
    • /usr/share/doc/php-manual-en/function.trader-atan.html
    • /usr/share/doc/php-manual-en/function.trader-atr.html
    • /usr/share/doc/php-manual-en/function.trader-avgprice.html
    • /usr/share/doc/php-manual-en/function.trader-bbands.html
    • /usr/share/doc/php-manual-en/function.trader-beta.html
    • /usr/share/doc/php-manual-en/function.trader-bop.html
    • /usr/share/doc/php-manual-en/function.trader-cci.html
    • /usr/share/doc/php-manual-en/function.trader-cdl2crows.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3blackcrows.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3inside.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3linestrike.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3outside.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3starsinsouth.html
    • /usr/share/doc/php-manual-en/function.trader-cdl3whitesoldiers.html
    • /usr/share/doc/php-manual-en/function.trader-cdlabandonedbaby.html
    • /usr/share/doc/php-manual-en/function.trader-cdladvanceblock.html
    • /usr/share/doc/php-manual-en/function.trader-cdlbelthold.html
    • /usr/share/doc/php-manual-en/function.trader-cdlbreakaway.html
    • /usr/share/doc/php-manual-en/function.trader-cdlclosingmarubozu.html
    • /usr/share/doc/php-manual-en/function.trader-cdlconcealbabyswall.html
    • /usr/share/doc/php-manual-en/function.trader-cdlcounterattack.html
    • /usr/share/doc/php-manual-en/function.trader-cdldarkcloudcover.html
    • /usr/share/doc/php-manual-en/function.trader-cdldoji.html
    • /usr/share/doc/php-manual-en/function.trader-cdldojistar.html
    • /usr/share/doc/php-manual-en/function.trader-cdldragonflydoji.html
    • /usr/share/doc/php-manual-en/function.trader-cdlengulfing.html
    • /usr/share/doc/php-manual-en/function.trader-cdleveningdojistar.html
    • /usr/share/doc/php-manual-en/function.trader-cdleveningstar.html
    • /usr/share/doc/php-manual-en/function.trader-cdlgapsidesidewhite.html
    • /usr/share/doc/php-manual-en/function.trader-cdlgravestonedoji.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhammer.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhangingman.html
    • /usr/share/doc/php-manual-en/function.trader-cdlharami.html
    • /usr/share/doc/php-manual-en/function.trader-cdlharamicross.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhighwave.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhikkake.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhikkakemod.html
    • /usr/share/doc/php-manual-en/function.trader-cdlhomingpigeon.html
    • /usr/share/doc/php-manual-en/function.trader-cdlidentical3crows.html
    • /usr/share/doc/php-manual-en/function.trader-cdlinneck.html
    • /usr/share/doc/php-manual-en/function.trader-cdlinvertedhammer.html
    • /usr/share/doc/php-manual-en/function.trader-cdlkicking.html
    • /usr/share/doc/php-manual-en/function.trader-cdlkickingbylength.html
    • /usr/share/doc/php-manual-en/function.trader-cdlladderbottom.html
    • /usr/share/doc/php-manual-en/function.trader-cdllongleggeddoji.html
    • /usr/share/doc/php-manual-en/function.trader-cdllongline.html
    • /usr/share/doc/php-manual-en/function.trader-cdlmarubozu.html
    • /usr/share/doc/php-manual-en/function.trader-cdlmatchinglow.html
    • /usr/share/doc/php-manual-en/function.trader-cdlmathold.html
    • /usr/share/doc/php-manual-en/function.trader-cdlmorningdojistar.html
    • /usr/share/doc/php-manual-en/function.trader-cdlmorningstar.html
    • /usr/share/doc/php-manual-en/function.trader-cdlonneck.html
    • /usr/share/doc/php-manual-en/function.trader-cdlpiercing.html
    • /usr/share/doc/php-manual-en/function.trader-cdlrickshawman.html
    • /usr/share/doc/php-manual-en/function.trader-cdlrisefall3methods.html
    • /usr/share/doc/php-manual-en/function.trader-cdlseparatinglines.html
    • /usr/share/doc/php-manual-en/function.trader-cdlshootingstar.html
    • /usr/share/doc/php-manual-en/function.trader-cdlshortline.html
    • /usr/share/doc/php-manual-en/function.trader-cdlspinningtop.html
    • /usr/share/doc/php-manual-en/function.trader-cdlstalledpattern.html
    • /usr/share/doc/php-manual-en/function.trader-cdlsticksandwich.html
    • /usr/share/doc/php-manual-en/function.trader-cdltakuri.html
    • /usr/share/doc/php-manual-en/function.trader-cdltasukigap.html
    • /usr/share/doc/php-manual-en/function.trader-cdlthrusting.html
    • /usr/share/doc/php-manual-en/function.trader-cdltristar.html
    • /usr/share/doc/php-manual-en/function.trader-cdlunique3river.html
    • /usr/share/doc/php-manual-en/function.trader-cdlupsidegap2crows.html
    • /usr/share/doc/php-manual-en/function.trader-cdlxsidegap3methods.html
    • /usr/share/doc/php-manual-en/function.trader-ceil.html
    • /usr/share/doc/php-manual-en/function.trader-cmo.html
    • /usr/share/doc/php-manual-en/function.trader-correl.html
    • /usr/share/doc/php-manual-en/function.trader-cos.html
    • /usr/share/doc/php-manual-en/function.trader-cosh.html
    • /usr/share/doc/php-manual-en/function.trader-dema.html
    • /usr/share/doc/php-manual-en/function.trader-div.html
    • /usr/share/doc/php-manual-en/function.trader-dx.html
    • /usr/share/doc/php-manual-en/function.trader-ema.html
    • /usr/share/doc/php-manual-en/function.trader-errno.html
    • /usr/share/doc/php-manual-en/function.trader-exp.html
    • /usr/share/doc/php-manual-en/function.trader-floor.html
    • /usr/share/doc/php-manual-en/function.trader-get-compat.html
    • /usr/share/doc/php-manual-en/function.trader-get-unstable-period.html
    • /usr/share/doc/php-manual-en/function.trader-ht-dcperiod.html
    • /usr/share/doc/php-manual-en/function.trader-ht-dcphase.html
    • /usr/share/doc/php-manual-en/function.trader-ht-phasor.html
    • /usr/share/doc/php-manual-en/function.trader-ht-sine.html
    • /usr/share/doc/php-manual-en/function.trader-ht-trendline.html
    • /usr/share/doc/php-manual-en/function.trader-ht-trendmode.html
    • /usr/share/doc/php-manual-en/function.trader-kama.html
    • /usr/share/doc/php-manual-en/function.trader-linearreg-angle.html
    • /usr/share/doc/php-manual-en/function.trader-linearreg-intercept.html
    • /usr/share/doc/php-manual-en/function.trader-linearreg-slope.html
    • /usr/share/doc/php-manual-en/function.trader-linearreg.html
    • /usr/share/doc/php-manual-en/function.trader-ln.html
    • /usr/share/doc/php-manual-en/function.trader-log10.html
    • /usr/share/doc/php-manual-en/function.trader-ma.html
    • /usr/share/doc/php-manual-en/function.trader-macd.html
    • /usr/share/doc/php-manual-en/function.trader-macdext.html
    • /usr/share/doc/php-manual-en/function.trader-macdfix.html
    • /usr/share/doc/php-manual-en/function.trader-mama.html
    • /usr/share/doc/php-manual-en/function.trader-mavp.html
    • /usr/share/doc/php-manual-en/function.trader-max.html
    • /usr/share/doc/php-manual-en/function.trader-maxindex.html
    • /usr/share/doc/php-manual-en/function.trader-medprice.html
    • /usr/share/doc/php-manual-en/function.trader-mfi.html
    • /usr/share/doc/php-manual-en/function.trader-midpoint.html
    • /usr/share/doc/php-manual-en/function.trader-midprice.html
    • /usr/share/doc/php-manual-en/function.trader-min.html
    • /usr/share/doc/php-manual-en/function.trader-minindex.html
    • /usr/share/doc/php-manual-en/function.trader-minmax.html
    • /usr/share/doc/php-manual-en/function.trader-minmaxindex.html
    • /usr/share/doc/php-manual-en/function.trader-minus-di.html
    • /usr/share/doc/php-manual-en/function.trader-minus-dm.html
    • /usr/share/doc/php-manual-en/function.trader-mom.html
    • /usr/share/doc/php-manual-en/function.trader-mult.html
    • /usr/share/doc/php-manual-en/function.trader-natr.html
    • /usr/share/doc/php-manual-en/function.trader-obv.html
    • /usr/share/doc/php-manual-en/function.trader-plus-di.html
    • /usr/share/doc/php-manual-en/function.trader-plus-dm.html
    • /usr/share/doc/php-manual-en/function.trader-ppo.html
    • /usr/share/doc/php-manual-en/function.trader-roc.html
    • /usr/share/doc/php-manual-en/function.trader-rocp.html
    • /usr/share/doc/php-manual-en/function.trader-rocr.html
    • /usr/share/doc/php-manual-en/function.trader-rocr100.html
    • /usr/share/doc/php-manual-en/function.trader-rsi.html
    • /usr/share/doc/php-manual-en/function.trader-sar.html
    • /usr/share/doc/php-manual-en/function.trader-sarext.html
    • /usr/share/doc/php-manual-en/function.trader-set-compat.html
    • /usr/share/doc/php-manual-en/function.trader-set-unstable-period.html
    • /usr/share/doc/php-manual-en/function.trader-sin.html
    • /usr/share/doc/php-manual-en/function.trader-sinh.html
    • /usr/share/doc/php-manual-en/function.trader-sma.html
    • /usr/share/doc/php-manual-en/function.trader-sqrt.html
    • /usr/share/doc/php-manual-en/function.trader-stddev.html
    • /usr/share/doc/php-manual-en/function.trader-stoch.html
    • /usr/share/doc/php-manual-en/function.trader-stochf.html
    • /usr/share/doc/php-manual-en/function.trader-stochrsi.html
    • /usr/share/doc/php-manual-en/function.trader-sub.html
    • /usr/share/doc/php-manual-en/function.trader-sum.html
    • /usr/share/doc/php-manual-en/function.trader-t3.html
    • /usr/share/doc/php-manual-en/function.trader-tan.html
    • /usr/share/doc/php-manual-en/function.trader-tanh.html
    • /usr/share/doc/php-manual-en/function.trader-tema.html
    • /usr/share/doc/php-manual-en/function.trader-trange.html
    • /usr/share/doc/php-manual-en/function.trader-trima.html
    • /usr/share/doc/php-manual-en/function.trader-trix.html
    • /usr/share/doc/php-manual-en/function.trader-tsf.html
    • /usr/share/doc/php-manual-en/function.trader-typprice.html
    • /usr/share/doc/php-manual-en/function.trader-ultosc.html
    • /usr/share/doc/php-manual-en/function.trader-var.html
    • /usr/share/doc/php-manual-en/function.trader-wclprice.html
    • /usr/share/doc/php-manual-en/function.trader-willr.html
    • /usr/share/doc/php-manual-en/function.trader-wma.html
    • /usr/share/doc/php-manual-en/function.trait-exists.html
    • /usr/share/doc/php-manual-en/function.trigger-error.html
    • /usr/share/doc/php-manual-en/function.trim.html
    • /usr/share/doc/php-manual-en/function.uasort.html
    • /usr/share/doc/php-manual-en/function.ucfirst.html
    • /usr/share/doc/php-manual-en/function.ucwords.html
    • /usr/share/doc/php-manual-en/function.udm-add-search-limit.html
    • /usr/share/doc/php-manual-en/function.udm-alloc-agent-array.html
    • /usr/share/doc/php-manual-en/function.udm-alloc-agent.html
    • /usr/share/doc/php-manual-en/function.udm-api-version.html
    • /usr/share/doc/php-manual-en/function.udm-cat-list.html
    • /usr/share/doc/php-manual-en/function.udm-cat-path.html
    • /usr/share/doc/php-manual-en/function.udm-check-charset.html
    • /usr/share/doc/php-manual-en/function.udm-check-stored.html
    • /usr/share/doc/php-manual-en/function.udm-clear-search-limits.html
    • /usr/share/doc/php-manual-en/function.udm-close-stored.html
    • /usr/share/doc/php-manual-en/function.udm-crc32.html
    • /usr/share/doc/php-manual-en/function.udm-errno.html
    • /usr/share/doc/php-manual-en/function.udm-error.html
    • /usr/share/doc/php-manual-en/function.udm-find.html
    • /usr/share/doc/php-manual-en/function.udm-free-agent.html
    • /usr/share/doc/php-manual-en/function.udm-free-ispell-data.html
    • /usr/share/doc/php-manual-en/function.udm-free-res.html
    • /usr/share/doc/php-manual-en/function.udm-get-doc-count.html
    • /usr/share/doc/php-manual-en/function.udm-get-res-field.html
    • /usr/share/doc/php-manual-en/function.udm-get-res-param.html
    • /usr/share/doc/php-manual-en/function.udm-hash32.html
    • /usr/share/doc/php-manual-en/function.udm-load-ispell-data.html
    • /usr/share/doc/php-manual-en/function.udm-open-stored.html
    • /usr/share/doc/php-manual-en/function.udm-set-agent-param.html
    • /usr/share/doc/php-manual-en/function.uksort.html
    • /usr/share/doc/php-manual-en/function.umask.html
    • /usr/share/doc/php-manual-en/function.uniqid.html
    • /usr/share/doc/php-manual-en/function.unixtojd.html
    • /usr/share/doc/php-manual-en/function.unlink.html
    • /usr/share/doc/php-manual-en/function.unpack.html
    • /usr/share/doc/php-manual-en/function.unregister-tick-function.html
    • /usr/share/doc/php-manual-en/function.unserialize.html
    • /usr/share/doc/php-manual-en/function.unset.html
    • /usr/share/doc/php-manual-en/function.untaint.html
    • /usr/share/doc/php-manual-en/function.urldecode.html
    • /usr/share/doc/php-manual-en/function.urlencode.html
    • /usr/share/doc/php-manual-en/function.use-soap-error-handler.html
    • /usr/share/doc/php-manual-en/function.user-error.html
    • /usr/share/doc/php-manual-en/function.usleep.html
    • /usr/share/doc/php-manual-en/function.usort.html
    • /usr/share/doc/php-manual-en/function.utf8-decode.html
    • /usr/share/doc/php-manual-en/function.utf8-encode.html
    • /usr/share/doc/php-manual-en/function.var-dump.html
    • /usr/share/doc/php-manual-en/function.var-export.html
    • /usr/share/doc/php-manual-en/function.variant-abs.html
    • /usr/share/doc/php-manual-en/function.variant-add.html
    • /usr/share/doc/php-manual-en/function.variant-and.html
    • /usr/share/doc/php-manual-en/function.variant-cast.html
    • /usr/share/doc/php-manual-en/function.variant-cat.html
    • /usr/share/doc/php-manual-en/function.variant-cmp.html
    • /usr/share/doc/php-manual-en/function.variant-date-from-timestamp.html
    • /usr/share/doc/php-manual-en/function.variant-date-to-timestamp.html
    • /usr/share/doc/php-manual-en/function.variant-div.html
    • /usr/share/doc/php-manual-en/function.variant-eqv.html
    • /usr/share/doc/php-manual-en/function.variant-fix.html
    • /usr/share/doc/php-manual-en/function.variant-get-type.html
    • /usr/share/doc/php-manual-en/function.variant-idiv.html
    • /usr/share/doc/php-manual-en/function.variant-imp.html
    • /usr/share/doc/php-manual-en/function.variant-int.html
    • /usr/share/doc/php-manual-en/function.variant-mod.html
    • /usr/share/doc/php-manual-en/function.variant-mul.html
    • /usr/share/doc/php-manual-en/function.variant-neg.html
    • /usr/share/doc/php-manual-en/function.variant-not.html
    • /usr/share/doc/php-manual-en/function.variant-or.html
    • /usr/share/doc/php-manual-en/function.variant-pow.html
    • /usr/share/doc/php-manual-en/function.variant-round.html
    • /usr/share/doc/php-manual-en/function.variant-set-type.html
    • /usr/share/doc/php-manual-en/function.variant-set.html
    • /usr/share/doc/php-manual-en/function.variant-sub.html
    • /usr/share/doc/php-manual-en/function.variant-xor.html
    • /usr/share/doc/php-manual-en/function.version-compare.html
    • /usr/share/doc/php-manual-en/function.vfprintf.html
    • /usr/share/doc/php-manual-en/function.virtual.html
    • /usr/share/doc/php-manual-en/function.vpopmail-add-alias-domain-ex.html
    • /usr/share/doc/php-manual-en/function.vpopmail-add-alias-domain.html
    • /usr/share/doc/php-manual-en/function.vpopmail-add-domain-ex.html
    • /usr/share/doc/php-manual-en/function.vpopmail-add-domain.html
    • /usr/share/doc/php-manual-en/function.vpopmail-add-user.html
    • /usr/share/doc/php-manual-en/function.vpopmail-alias-add.html
    • /usr/share/doc/php-manual-en/function.vpopmail-alias-del-domain.html
    • /usr/share/doc/php-manual-en/function.vpopmail-alias-del.html
    • /usr/share/doc/php-manual-en/function.vpopmail-alias-get-all.html
    • /usr/share/doc/php-manual-en/function.vpopmail-alias-get.html
    • /usr/share/doc/php-manual-en/function.vpopmail-auth-user.html
    • /usr/share/doc/php-manual-en/function.vpopmail-del-domain-ex.html
    • /usr/share/doc/php-manual-en/function.vpopmail-del-domain.html
    • /usr/share/doc/php-manual-en/function.vpopmail-del-user.html
    • /usr/share/doc/php-manual-en/function.vpopmail-error.html
    • /usr/share/doc/php-manual-en/function.vpopmail-passwd.html
    • /usr/share/doc/php-manual-en/function.vpopmail-set-user-quota.html
    • /usr/share/doc/php-manual-en/function.vprintf.html
    • /usr/share/doc/php-manual-en/function.vsprintf.html
    • /usr/share/doc/php-manual-en/function.w32api-deftype.html
    • /usr/share/doc/php-manual-en/function.w32api-init-dtype.html
    • /usr/share/doc/php-manual-en/function.w32api-invoke-function.html
    • /usr/share/doc/php-manual-en/function.w32api-register-function.html
    • /usr/share/doc/php-manual-en/function.w32api-set-call-method.html
    • /usr/share/doc/php-manual-en/function.wddx-add-vars.html
    • /usr/share/doc/php-manual-en/function.wddx-deserialize.html
    • /usr/share/doc/php-manual-en/function.wddx-packet-end.html
    • /usr/share/doc/php-manual-en/function.wddx-packet-start.html
    • /usr/share/doc/php-manual-en/function.wddx-serialize-value.html
    • /usr/share/doc/php-manual-en/function.wddx-serialize-vars.html
    • /usr/share/doc/php-manual-en/function.win32-continue-service.html
    • /usr/share/doc/php-manual-en/function.win32-create-service.html
    • /usr/share/doc/php-manual-en/function.win32-delete-service.html
    • /usr/share/doc/php-manual-en/function.win32-get-last-control-message.html
    • /usr/share/doc/php-manual-en/function.win32-pause-service.html
    • /usr/share/doc/php-manual-en/function.win32-ps-list-procs.html
    • /usr/share/doc/php-manual-en/function.win32-ps-stat-mem.html
    • /usr/share/doc/php-manual-en/function.win32-ps-stat-proc.html
    • /usr/share/doc/php-manual-en/function.win32-query-service-status.html
    • /usr/share/doc/php-manual-en/function.win32-set-service-status.html
    • /usr/share/doc/php-manual-en/function.win32-start-service-ctrl-dispatcher.html
    • /usr/share/doc/php-manual-en/function.win32-start-service.html
    • /usr/share/doc/php-manual-en/function.win32-stop-service.html
    • /usr/share/doc/php-manual-en/function.wincache-fcache-fileinfo.html
    • /usr/share/doc/php-manual-en/function.wincache-fcache-meminfo.html
    • /usr/share/doc/php-manual-en/function.wincache-lock.html
    • /usr/share/doc/php-manual-en/function.wincache-ocache-fileinfo.html
    • /usr/share/doc/php-manual-en/function.wincache-ocache-meminfo.html
    • /usr/share/doc/php-manual-en/function.wincache-refresh-if-changed.html
    • /usr/share/doc/php-manual-en/function.wincache-rplist-fileinfo.html
    • /usr/share/doc/php-manual-en/function.wincache-rplist-meminfo.html
    • /usr/share/doc/php-manual-en/function.wincache-scache-info.html
    • /usr/share/doc/php-manual-en/function.wincache-scache-meminfo.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-add.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-cas.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-clear.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-dec.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-delete.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-exists.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-get.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-inc.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-info.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-meminfo.html
    • /usr/share/doc/php-manual-en/function.wincache-ucache-set.html
    • /usr/share/doc/php-manual-en/function.wincache-unlock.html
    • /usr/share/doc/php-manual-en/function.wordwrap.html
    • /usr/share/doc/php-manual-en/function.xattr-get.html
    • /usr/share/doc/php-manual-en/function.xattr-list.html
    • /usr/share/doc/php-manual-en/function.xattr-remove.html
    • /usr/share/doc/php-manual-en/function.xattr-set.html
    • /usr/share/doc/php-manual-en/function.xattr-supported.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-bdiff-size.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-bdiff.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-bpatch.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-diff-binary.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-diff.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-merge3.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-patch-binary.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-patch.html
    • /usr/share/doc/php-manual-en/function.xdiff-file-rabdiff.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-bdiff-size.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-bdiff.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-bpatch.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-diff-binary.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-diff.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-merge3.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-patch-binary.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-patch.html
    • /usr/share/doc/php-manual-en/function.xdiff-string-rabdiff.html
    • /usr/share/doc/php-manual-en/function.xhprof-disable.html
    • /usr/share/doc/php-manual-en/function.xhprof-enable.html
    • /usr/share/doc/php-manual-en/function.xhprof-sample-disable.html
    • /usr/share/doc/php-manual-en/function.xhprof-sample-enable.html
    • /usr/share/doc/php-manual-en/function.xml-error-string.html
    • /usr/share/doc/php-manual-en/function.xml-get-current-byte-index.html
    • /usr/share/doc/php-manual-en/function.xml-get-current-column-number.html
    • /usr/share/doc/php-manual-en/function.xml-get-current-line-number.html
    • /usr/share/doc/php-manual-en/function.xml-get-error-code.html
    • /usr/share/doc/php-manual-en/function.xml-parse-into-struct.html
    • /usr/share/doc/php-manual-en/function.xml-parse.html
    • /usr/share/doc/php-manual-en/function.xml-parser-create-ns.html
    • /usr/share/doc/php-manual-en/function.xml-parser-create.html
    • /usr/share/doc/php-manual-en/function.xml-parser-free.html
    • /usr/share/doc/php-manual-en/function.xml-parser-get-option.html
    • /usr/share/doc/php-manual-en/function.xml-parser-set-option.html
    • /usr/share/doc/php-manual-en/function.xml-set-character-data-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-default-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-element-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-end-namespace-decl-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-external-entity-ref-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-notation-decl-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-object.html
    • /usr/share/doc/php-manual-en/function.xml-set-processing-instruction-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-start-namespace-decl-handler.html
    • /usr/share/doc/php-manual-en/function.xml-set-unparsed-entity-decl-handler.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-decode-request.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-decode.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-encode-request.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-encode.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-get-type.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-is-fault.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-parse-method-descriptions.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-add-introspection-data.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-call-method.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-create.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-destroy.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-register-introspection-callback.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-server-register-method.html
    • /usr/share/doc/php-manual-en/function.xmlrpc-set-type.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-attribute.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-cdata.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-comment.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-document.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-dtd-attlist.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-dtd-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-dtd-entity.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-dtd.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-end-pi.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-flush.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-full-end-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-open-memory.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-open-uri.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-output-memory.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-set-indent-string.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-set-indent.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-attribute-ns.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-attribute.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-cdata.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-comment.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-document.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-dtd-attlist.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-dtd-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-dtd-entity.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-dtd.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-element-ns.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-start-pi.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-text.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-attribute-ns.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-attribute.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-cdata.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-comment.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-dtd-attlist.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-dtd-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-dtd-entity.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-dtd.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-element-ns.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-element.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-pi.html
    • /usr/share/doc/php-manual-en/function.xmlwriter-write-raw.html
    • /usr/share/doc/php-manual-en/function.xslt-backend-info.html
    • /usr/share/doc/php-manual-en/function.xslt-backend-name.html
    • /usr/share/doc/php-manual-en/function.xslt-backend-version.html
    • /usr/share/doc/php-manual-en/function.xslt-create.html
    • /usr/share/doc/php-manual-en/function.xslt-errno.html
    • /usr/share/doc/php-manual-en/function.xslt-error.html
    • /usr/share/doc/php-manual-en/function.xslt-free.html
    • /usr/share/doc/php-manual-en/function.xslt-getopt.html
    • /usr/share/doc/php-manual-en/function.xslt-process.html
    • /usr/share/doc/php-manual-en/function.xslt-set-base.html
    • /usr/share/doc/php-manual-en/function.xslt-set-encoding.html
    • /usr/share/doc/php-manual-en/function.xslt-set-error-handler.html
    • /usr/share/doc/php-manual-en/function.xslt-set-log.html
    • /usr/share/doc/php-manual-en/function.xslt-set-object.html
    • /usr/share/doc/php-manual-en/function.xslt-set-sax-handler.html
    • /usr/share/doc/php-manual-en/function.xslt-set-sax-handlers.html
    • /usr/share/doc/php-manual-en/function.xslt-set-scheme-handler.html
    • /usr/share/doc/php-manual-en/function.xslt-set-scheme-handlers.html
    • /usr/share/doc/php-manual-en/function.xslt-setopt.html
    • /usr/share/doc/php-manual-en/function.yaml-emit-file.html
    • /usr/share/doc/php-manual-en/function.yaml-emit.html
    • /usr/share/doc/php-manual-en/function.yaml-parse-file.html
    • /usr/share/doc/php-manual-en/function.yaml-parse-url.html
    • /usr/share/doc/php-manual-en/function.yaml-parse.html
    • /usr/share/doc/php-manual-en/function.yaz-addinfo.html
    • /usr/share/doc/php-manual-en/function.yaz-ccl-conf.html
    • /usr/share/doc/php-manual-en/function.yaz-ccl-parse.html
    • /usr/share/doc/php-manual-en/function.yaz-close.html
    • /usr/share/doc/php-manual-en/function.yaz-connect.html
    • /usr/share/doc/php-manual-en/function.yaz-database.html
    • /usr/share/doc/php-manual-en/function.yaz-element.html
    • /usr/share/doc/php-manual-en/function.yaz-errno.html
    • /usr/share/doc/php-manual-en/function.yaz-error.html
    • /usr/share/doc/php-manual-en/function.yaz-es-result.html
    • /usr/share/doc/php-manual-en/function.yaz-es.html
    • /usr/share/doc/php-manual-en/function.yaz-get-option.html
    • /usr/share/doc/php-manual-en/function.yaz-hits.html
    • /usr/share/doc/php-manual-en/function.yaz-itemorder.html
    • /usr/share/doc/php-manual-en/function.yaz-present.html
    • /usr/share/doc/php-manual-en/function.yaz-range.html
    • /usr/share/doc/php-manual-en/function.yaz-record.html
    • /usr/share/doc/php-manual-en/function.yaz-scan-result.html
    • /usr/share/doc/php-manual-en/function.yaz-scan.html
    • /usr/share/doc/php-manual-en/function.yaz-schema.html
    • /usr/share/doc/php-manual-en/function.yaz-search.html
    • /usr/share/doc/php-manual-en/function.yaz-set-option.html
    • /usr/share/doc/php-manual-en/function.yaz-sort.html
    • /usr/share/doc/php-manual-en/function.yaz-syntax.html
    • /usr/share/doc/php-manual-en/function.yaz-wait.html
    • /usr/share/doc/php-manual-en/function.yp-all.html
    • /usr/share/doc/php-manual-en/function.yp-cat.html
    • /usr/share/doc/php-manual-en/function.yp-err-string.html
    • /usr/share/doc/php-manual-en/function.yp-errno.html
    • /usr/share/doc/php-manual-en/function.yp-first.html
    • /usr/share/doc/php-manual-en/function.yp-get-default-domain.html
    • /usr/share/doc/php-manual-en/function.yp-master.html
    • /usr/share/doc/php-manual-en/function.yp-match.html
    • /usr/share/doc/php-manual-en/function.yp-next.html
    • /usr/share/doc/php-manual-en/function.yp-order.html
    • /usr/share/doc/php-manual-en/function.zend-logo-guid.html
    • /usr/share/doc/php-manual-en/function.zend-thread-id.html
    • /usr/share/doc/php-manual-en/function.zend-version.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/function.zlib-decode.html
    • /usr/share/doc/php-manual-en/function.zlib-encode.html
    • /usr/share/doc/php-manual-en/function.zlib-get-coding-type.html
    • /usr/share/doc/php-manual-en/functions.anonymous.html
    • /usr/share/doc/php-manual-en/functions.arguments.html
    • /usr/share/doc/php-manual-en/functions.internal.html
    • /usr/share/doc/php-manual-en/functions.returning-values.html
    • /usr/share/doc/php-manual-en/functions.user-defined.html
    • /usr/share/doc/php-manual-en/functions.variable-functions.html
    • /usr/share/doc/php-manual-en/gearman.configuration.html
    • /usr/share/doc/php-manual-en/gearman.constants.html
    • /usr/share/doc/php-manual-en/gearman.examples-reverse-bg.html
    • /usr/share/doc/php-manual-en/gearman.examples-reverse-task.html
    • /usr/share/doc/php-manual-en/gearman.examples-reverse.html
    • /usr/share/doc/php-manual-en/gearman.examples.html
    • /usr/share/doc/php-manual-en/gearman.installation.html
    • /usr/share/doc/php-manual-en/gearman.requirements.html
    • /usr/share/doc/php-manual-en/gearman.resources.html
    • /usr/share/doc/php-manual-en/gearman.setup.html
    • /usr/share/doc/php-manual-en/gearmanclient.addoptions.html
    • /usr/share/doc/php-manual-en/gearmanclient.addserver.html
    • /usr/share/doc/php-manual-en/gearmanclient.addservers.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtask.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtaskbackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtaskhigh.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtaskhighbackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtasklow.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtasklowbackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.addtaskstatus.html
    • /usr/share/doc/php-manual-en/gearmanclient.clearcallbacks.html
    • /usr/share/doc/php-manual-en/gearmanclient.clone.html
    • /usr/share/doc/php-manual-en/gearmanclient.construct.html
    • /usr/share/doc/php-manual-en/gearmanclient.context.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gearmanclient.dobackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.dohigh.html
    • /usr/share/doc/php-manual-en/gearmanclient.dohighbackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.dojobhandle.html
    • /usr/share/doc/php-manual-en/gearmanclient.dolow.html
    • /usr/share/doc/php-manual-en/gearmanclient.dolowbackground.html
    • /usr/share/doc/php-manual-en/gearmanclient.donormal.html
    • /usr/share/doc/php-manual-en/gearmanclient.dostatus.html
    • /usr/share/doc/php-manual-en/gearmanclient.echo.html
    • /usr/share/doc/php-manual-en/gearmanclient.error.html
    • /usr/share/doc/php-manual-en/gearmanclient.geterrno.html
    • /usr/share/doc/php-manual-en/gearmanclient.jobstatus.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gearmanclient.removeoptions.html
    • /usr/share/doc/php-manual-en/gearmanclient.returncode.html
    • /usr/share/doc/php-manual-en/gearmanclient.runtasks.html
    • /usr/share/doc/php-manual-en/gearmanclient.setclientcallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setcompletecallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setcontext.html
    • /usr/share/doc/php-manual-en/gearmanclient.setcreatedcallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setdata.html
    • /usr/share/doc/php-manual-en/gearmanclient.setdatacallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setexceptioncallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setfailcallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setoptions.html
    • /usr/share/doc/php-manual-en/gearmanclient.setstatuscallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.settimeout.html
    • /usr/share/doc/php-manual-en/gearmanclient.setwarningcallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.setworkloadcallback.html
    • /usr/share/doc/php-manual-en/gearmanclient.timeout.html
    • /usr/share/doc/php-manual-en/gearmanjob.complete.html
    • /usr/share/doc/php-manual-en/gearmanjob.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gearmanjob.exception.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gearmanjob.functionname.html
    • /usr/share/doc/php-manual-en/gearmanjob.handle.html
    • /usr/share/doc/php-manual-en/gearmanjob.returncode.html
    • /usr/share/doc/php-manual-en/gearmanjob.sendcomplete.html
    • /usr/share/doc/php-manual-en/gearmanjob.senddata.html
    • /usr/share/doc/php-manual-en/gearmanjob.sendexception.html
    • /usr/share/doc/php-manual-en/gearmanjob.sendfail.html
    • /usr/share/doc/php-manual-en/gearmanjob.sendstatus.html
    • /usr/share/doc/php-manual-en/gearmanjob.sendwarning.html
    • /usr/share/doc/php-manual-en/gearmanjob.setreturn.html
    • /usr/share/doc/php-manual-en/gearmanjob.status.html
    • /usr/share/doc/php-manual-en/gearmanjob.unique.html
    • /usr/share/doc/php-manual-en/gearmanjob.warning.html
    • /usr/share/doc/php-manual-en/gearmanjob.workload.html
    • /usr/share/doc/php-manual-en/gearmanjob.workloadsize.html
    • /usr/share/doc/php-manual-en/gearmantask.construct.html
    • /usr/share/doc/php-manual-en/gearmantask.create.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gearmantask.datasize.html
    • /usr/share/doc/php-manual-en/gearmantask.function.html
    • /usr/share/doc/php-manual-en/gearmantask.functionname.html
    • /usr/share/doc/php-manual-en/gearmantask.isknown.html
    • /usr/share/doc/php-manual-en/gearmantask.isrunning.html
    • /usr/share/doc/php-manual-en/gearmantask.jobhandle.html
    • /usr/share/doc/php-manual-en/gearmantask.recvdata.html
    • /usr/share/doc/php-manual-en/gearmantask.returncode.html
    • /usr/share/doc/php-manual-en/gearmantask.senddata.html
    • /usr/share/doc/php-manual-en/gearmantask.sendworkload.html
    • /usr/share/doc/php-manual-en/gearmantask.taskdenominator.html
    • /usr/share/doc/php-manual-en/gearmantask.tasknumerator.html
    • /usr/share/doc/php-manual-en/gearmantask.unique.html
    • /usr/share/doc/php-manual-en/gearmantask.uuid.html
    • /usr/share/doc/php-manual-en/gearmanworker.addfunction.html
    • /usr/share/doc/php-manual-en/gearmanworker.addoptions.html
    • /usr/share/doc/php-manual-en/gearmanworker.addserver.html
    • /usr/share/doc/php-manual-en/gearmanworker.addservers.html
    • /usr/share/doc/php-manual-en/gearmanworker.clone.html
    • /usr/share/doc/php-manual-en/gearmanworker.construct.html
    • /usr/share/doc/php-manual-en/gearmanworker.echo.html
    • /usr/share/doc/php-manual-en/gearmanworker.error.html
    • /usr/share/doc/php-manual-en/gearmanworker.geterrno.html
    • /usr/share/doc/php-manual-en/gearmanworker.options.html
    • /usr/share/doc/php-manual-en/gearmanworker.register.html
    • /usr/share/doc/php-manual-en/gearmanworker.removeoptions.html
    • /usr/share/doc/php-manual-en/gearmanworker.returncode.html
    • /usr/share/doc/php-manual-en/gearmanworker.setoptions.html
    • /usr/share/doc/php-manual-en/gearmanworker.settimeout.html
    • /usr/share/doc/php-manual-en/gearmanworker.timeout.html
    • /usr/share/doc/php-manual-en/gearmanworker.unregister.html
    • /usr/share/doc/php-manual-en/gearmanworker.unregisterall.html
    • /usr/share/doc/php-manual-en/gearmanworker.wait.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gender-gender.connect.html
    • /usr/share/doc/php-manual-en/gender-gender.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gender-gender.get.html
    • /usr/share/doc/php-manual-en/gender-gender.isnick.html
    • /usr/share/doc/php-manual-en/gender-gender.similarnames.html
    • /usr/share/doc/php-manual-en/gender.example.admin.html
    • /usr/share/doc/php-manual-en/gender.examples.html
    • /usr/share/doc/php-manual-en/gender.installation.html
    • /usr/share/doc/php-manual-en/gender.setup.html
    • /usr/share/doc/php-manual-en/generator.current.html
    • /usr/share/doc/php-manual-en/generator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/generator.rewind.html
    • /usr/share/doc/php-manual-en/generator.send.html
    • /usr/share/doc/php-manual-en/generator.throw.html
    • /usr/share/doc/php-manual-en/generator.valid.html
    • /usr/share/doc/php-manual-en/generator.wakeup.html
    • /usr/share/doc/php-manual-en/geoip.configuration.html
    • /usr/share/doc/php-manual-en/geoip.constants.html
    • /usr/share/doc/php-manual-en/geoip.installation.html
    • /usr/share/doc/php-manual-en/geoip.requirements.html
    • /usr/share/doc/php-manual-en/geoip.resources.html
    • /usr/share/doc/php-manual-en/geoip.setup.html
    • /usr/share/doc/php-manual-en/gettext.configuration.html
    • /usr/share/doc/php-manual-en/gettext.constants.html
    • /usr/share/doc/php-manual-en/gettext.installation.html
    • /usr/share/doc/php-manual-en/gettext.requirements.html
    • /usr/share/doc/php-manual-en/gettext.resources.html
    • /usr/share/doc/php-manual-en/gettext.setup.html
    • /usr/share/doc/php-manual-en/getting-started.html
    • /usr/share/doc/php-manual-en/globiterator.construct.html
    • /usr/share/doc/php-manual-en/globiterator.count.html
    • /usr/share/doc/php-manual-en/gmagick.addimage.html
    • /usr/share/doc/php-manual-en/gmagick.addnoiseimage.html
    • /usr/share/doc/php-manual-en/gmagick.annotateimage.html
    • /usr/share/doc/php-manual-en/gmagick.blurimage.html
    • /usr/share/doc/php-manual-en/gmagick.borderimage.html
    • /usr/share/doc/php-manual-en/gmagick.charcoalimage.html
    • /usr/share/doc/php-manual-en/gmagick.chopimage.html
    • /usr/share/doc/php-manual-en/gmagick.clear.html
    • /usr/share/doc/php-manual-en/gmagick.commentimage.html
    • /usr/share/doc/php-manual-en/gmagick.compositeimage.html
    • /usr/share/doc/php-manual-en/gmagick.configuration.html
    • /usr/share/doc/php-manual-en/gmagick.constants.html
    • /usr/share/doc/php-manual-en/gmagick.construct.html
    • /usr/share/doc/php-manual-en/gmagick.cropimage.html
    • /usr/share/doc/php-manual-en/gmagick.cropthumbnailimage.html
    • /usr/share/doc/php-manual-en/gmagick.current.html
    • /usr/share/doc/php-manual-en/gmagick.cyclecolormapimage.html
    • /usr/share/doc/php-manual-en/gmagick.deconstructimages.html
    • /usr/share/doc/php-manual-en/gmagick.despeckleimage.html
    • /usr/share/doc/php-manual-en/gmagick.destroy.html
    • /usr/share/doc/php-manual-en/gmagick.drawimage.html
    • /usr/share/doc/php-manual-en/gmagick.edgeimage.html
    • /usr/share/doc/php-manual-en/gmagick.embossimage.html
    • /usr/share/doc/php-manual-en/gmagick.enhanceimage.html
    • /usr/share/doc/php-manual-en/gmagick.equalizeimage.html
    • /usr/share/doc/php-manual-en/gmagick.examples.html
    • /usr/share/doc/php-manual-en/gmagick.flipimage.html
    • /usr/share/doc/php-manual-en/gmagick.flopimage.html
    • /usr/share/doc/php-manual-en/gmagick.frameimage.html
    • /usr/share/doc/php-manual-en/gmagick.gammaimage.html
    • /usr/share/doc/php-manual-en/gmagick.getcopyright.html
    • /usr/share/doc/php-manual-en/gmagick.getfilename.html
    • /usr/share/doc/php-manual-en/gmagick.getimagebackgroundcolor.html
    • /usr/share/doc/php-manual-en/gmagick.getimageblueprimary.html
    • /usr/share/doc/php-manual-en/gmagick.getimagebordercolor.html
    • /usr/share/doc/php-manual-en/gmagick.getimagechanneldepth.html
    • /usr/share/doc/php-manual-en/gmagick.getimagecolors.html
    • /usr/share/doc/php-manual-en/gmagick.getimagecolorspace.html
    • /usr/share/doc/php-manual-en/gmagick.getimagecompose.html
    • /usr/share/doc/php-manual-en/gmagick.getimagedelay.html
    • /usr/share/doc/php-manual-en/gmagick.getimagedepth.html
    • /usr/share/doc/php-manual-en/gmagick.getimagedispose.html
    • /usr/share/doc/php-manual-en/gmagick.getimageextrema.html
    • /usr/share/doc/php-manual-en/gmagick.getimagefilename.html
    • /usr/share/doc/php-manual-en/gmagick.getimageformat.html
    • /usr/share/doc/php-manual-en/gmagick.getimagegamma.html
    • /usr/share/doc/php-manual-en/gmagick.getimagegreenprimary.html
    • /usr/share/doc/php-manual-en/gmagick.getimageheight.html
    • /usr/share/doc/php-manual-en/gmagick.getimagehistogram.html
    • /usr/share/doc/php-manual-en/gmagick.getimageindex.html
    • /usr/share/doc/php-manual-en/gmagick.getimageinterlacescheme.html
    • /usr/share/doc/php-manual-en/gmagick.getimageiterations.html
    • /usr/share/doc/php-manual-en/gmagick.getimagematte.html
    • /usr/share/doc/php-manual-en/gmagick.getimagemattecolor.html
    • /usr/share/doc/php-manual-en/gmagick.getimageprofile.html
    • /usr/share/doc/php-manual-en/gmagick.getimageredprimary.html
    • /usr/share/doc/php-manual-en/gmagick.getimagerenderingintent.html
    • /usr/share/doc/php-manual-en/gmagick.getimageresolution.html
    • /usr/share/doc/php-manual-en/gmagick.getimagescene.html
    • /usr/share/doc/php-manual-en/gmagick.getimagesignature.html
    • /usr/share/doc/php-manual-en/gmagick.getimagetype.html
    • /usr/share/doc/php-manual-en/gmagick.getimageunits.html
    • /usr/share/doc/php-manual-en/gmagick.getimagewhitepoint.html
    • /usr/share/doc/php-manual-en/gmagick.getimagewidth.html
    • /usr/share/doc/php-manual-en/gmagick.getpackagename.html
    • /usr/share/doc/php-manual-en/gmagick.getquantumdepth.html
    • /usr/share/doc/php-manual-en/gmagick.getreleasedate.html
    • /usr/share/doc/php-manual-en/gmagick.getsamplingfactors.html
    • /usr/share/doc/php-manual-en/gmagick.getsize.html
    • /usr/share/doc/php-manual-en/gmagick.getversion.html
    • /usr/share/doc/php-manual-en/gmagick.hasnextimage.html
    • /usr/share/doc/php-manual-en/gmagick.haspreviousimage.html
    • /usr/share/doc/php-manual-en/gmagick.implodeimage.html
    • /usr/share/doc/php-manual-en/gmagick.installation.html
    • /usr/share/doc/php-manual-en/gmagick.labelimage.html
    • /usr/share/doc/php-manual-en/gmagick.levelimage.html
    • /usr/share/doc/php-manual-en/gmagick.magnifyimage.html
    • /usr/share/doc/php-manual-en/gmagick.mapimage.html
    • /usr/share/doc/php-manual-en/gmagick.medianfilterimage.html
    • /usr/share/doc/php-manual-en/gmagick.minifyimage.html
    • /usr/share/doc/php-manual-en/gmagick.modulateimage.html
    • /usr/share/doc/php-manual-en/gmagick.motionblurimage.html
    • /usr/share/doc/php-manual-en/gmagick.newimage.html
    • /usr/share/doc/php-manual-en/gmagick.nextimage.html
    • /usr/share/doc/php-manual-en/gmagick.normalizeimage.html
    • /usr/share/doc/php-manual-en/gmagick.oilpaintimage.html
    • /usr/share/doc/php-manual-en/gmagick.previousimage.html
    • /usr/share/doc/php-manual-en/gmagick.profileimage.html
    • /usr/share/doc/php-manual-en/gmagick.quantizeimage.html
    • /usr/share/doc/php-manual-en/gmagick.quantizeimages.html
    • /usr/share/doc/php-manual-en/gmagick.queryfontmetrics.html
    • /usr/share/doc/php-manual-en/gmagick.queryfonts.html
    • /usr/share/doc/php-manual-en/gmagick.queryformats.html
    • /usr/share/doc/php-manual-en/gmagick.radialblurimage.html
    • /usr/share/doc/php-manual-en/gmagick.raiseimage.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/gmagick.readimage.html
    • /usr/share/doc/php-manual-en/gmagick.readimageblob.html
    • /usr/share/doc/php-manual-en/gmagick.readimagefile.html
    • /usr/share/doc/php-manual-en/gmagick.reducenoiseimage.html
    • /usr/share/doc/php-manual-en/gmagick.removeimage.html
    • /usr/share/doc/php-manual-en/gmagick.removeimageprofile.html
    • /usr/share/doc/php-manual-en/gmagick.requirements.html
    • /usr/share/doc/php-manual-en/gmagick.resampleimage.html
    • /usr/share/doc/php-manual-en/gmagick.resizeimage.html
    • /usr/share/doc/php-manual-en/gmagick.rollimage.html
    • /usr/share/doc/php-manual-en/gmagick.rotateimage.html
    • /usr/share/doc/php-manual-en/gmagick.scaleimage.html
    • /usr/share/doc/php-manual-en/gmagick.separateimagechannel.html
    • /usr/share/doc/php-manual-en/gmagick.setfilename.html
    • /usr/share/doc/php-manual-en/gmagick.setimagebackgroundcolor.html
    • /usr/share/doc/php-manual-en/gmagick.setimageblueprimary.html
    • /usr/share/doc/php-manual-en/gmagick.setimagebordercolor.html
    • /usr/share/doc/php-manual-en/gmagick.setimagechanneldepth.html
    • /usr/share/doc/php-manual-en/gmagick.setimagecolorspace.html
    • /usr/share/doc/php-manual-en/gmagick.setimagecompose.html
    • /usr/share/doc/php-manual-en/gmagick.setimagedelay.html
    • /usr/share/doc/php-manual-en/gmagick.setimagedepth.html
    • /usr/share/doc/php-manual-en/gmagick.setimagedispose.html
    • /usr/share/doc/php-manual-en/gmagick.setimagefilename.html
    • /usr/share/doc/php-manual-en/gmagick.setimageformat.html
    • /usr/share/doc/php-manual-en/gmagick.setimagegamma.html
    • /usr/share/doc/php-manual-en/gmagick.setimagegreenprimary.html
    • /usr/share/doc/php-manual-en/gmagick.setimageindex.html
    • /usr/share/doc/php-manual-en/gmagick.setimageinterlacescheme.html
    • /usr/share/doc/php-manual-en/gmagick.setimageiterations.html
    • /usr/share/doc/php-manual-en/gmagick.setimageprofile.html
    • /usr/share/doc/php-manual-en/gmagick.setimageredprimary.html
    • /usr/share/doc/php-manual-en/gmagick.setimagerenderingintent.html
    • /usr/share/doc/php-manual-en/gmagick.setimageresolution.html
    • /usr/share/doc/php-manual-en/gmagick.setimagescene.html
    • /usr/share/doc/php-manual-en/gmagick.setimagetype.html
    • /usr/share/doc/php-manual-en/gmagick.setimageunits.html
    • /usr/share/doc/php-manual-en/gmagick.setimagewhitepoint.html
    • /usr/share/doc/php-manual-en/gmagick.setsamplingfactors.html
    • /usr/share/doc/php-manual-en/gmagick.setsize.html
    • /usr/share/doc/php-manual-en/gmagick.setup.html
    • /usr/share/doc/php-manual-en/gmagick.shearimage.html
    • /usr/share/doc/php-manual-en/gmagick.solarizeimage.html
    • /usr/share/doc/php-manual-en/gmagick.spreadimage.html
    • /usr/share/doc/php-manual-en/gmagick.stripimage.html
    • /usr/share/doc/php-manual-en/gmagick.swirlimage.html
    • /usr/share/doc/php-manual-en/gmagick.thumbnailimage.html
    • /usr/share/doc/php-manual-en/gmagick.trimimage.html
    • /usr/share/doc/php-manual-en/gmagick.write.html
    • /usr/share/doc/php-manual-en/gmagick.writeimage.html
    • /usr/share/doc/php-manual-en/gmagickdraw.annotate.html
    • /usr/share/doc/php-manual-en/gmagickdraw.arc.html
    • /usr/share/doc/php-manual-en/gmagickdraw.bezier.html
    • /usr/share/doc/php-manual-en/gmagickdraw.ellipse.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfillcolor.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfillopacity.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfont.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfontsize.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfontstyle.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getfontweight.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getstrokecolor.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getstrokeopacity.html
    • /usr/share/doc/php-manual-en/gmagickdraw.getstrokewidth.html
    • /usr/share/doc/php-manual-en/gmagickdraw.gettextdecoration.html
    • /usr/share/doc/php-manual-en/gmagickdraw.gettextencoding.html
    • /usr/share/doc/php-manual-en/gmagickdraw.line.html
    • /usr/share/doc/php-manual-en/gmagickdraw.point.html
    • /usr/share/doc/php-manual-en/gmagickdraw.polygon.html
    • /usr/share/doc/php-manual-en/gmagickdraw.polyline.html
    • /usr/share/doc/php-manual-en/gmagickdraw.rectangle.html
    • /usr/share/doc/php-manual-en/gmagickdraw.rotate.html
    • /usr/share/doc/php-manual-en/gmagickdraw.roundrectangle.html
    • /usr/share/doc/php-manual-en/gmagickdraw.scale.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfillcolor.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfillopacity.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfont.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfontsize.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfontstyle.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setfontweight.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setstrokecolor.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setstrokeopacity.html
    • /usr/share/doc/php-manual-en/gmagickdraw.setstrokewidth.html
    • /usr/share/doc/php-manual-en/gmagickdraw.settextdecoration.html
    • /usr/share/doc/php-manual-en/gmagickdraw.settextencoding.html
    • /usr/share/doc/php-manual-en/gmagickpixel.construct.html
    • /usr/share/doc/php-manual-en/gmagickpixel.getcolor.html
    • /usr/share/doc/php-manual-en/gmagickpixel.getcolorcount.html
    • /usr/share/doc/php-manual-en/gmagickpixel.getcolorvalue.html
    • /usr/share/doc/php-manual-en/gmagickpixel.setcolor.html
    • /usr/share/doc/php-manual-en/gmagickpixel.setcolorvalue.html
    • /usr/share/doc/php-manual-en/gmp.configuration.html
    • /usr/share/doc/php-manual-en/gmp.constants.html
    • /usr/share/doc/php-manual-en/gmp.examples.html
    • /usr/share/doc/php-manual-en/gmp.installation.html
    • /usr/share/doc/php-manual-en/gmp.requirements.html
    • /usr/share/doc/php-manual-en/gmp.resources.html
    • /usr/share/doc/php-manual-en/gmp.setup.html
    • /usr/share/doc/php-manual-en/gnupg.configuration.html
    • /usr/share/doc/php-manual-en/gnupg.constants.html
    • /usr/share/doc/php-manual-en/gnupg.examples-clearsign.html
    • /usr/share/doc/php-manual-en/gnupg.examples.html
    • /usr/share/doc/php-manual-en/gnupg.installation.html
    • /usr/share/doc/php-manual-en/gnupg.requirements.html
    • /usr/share/doc/php-manual-en/gnupg.resources.html
    • /usr/share/doc/php-manual-en/gnupg.setup.html
    • /usr/share/doc/php-manual-en/gupnp-service-proxy-send-action.html
    • /usr/share/doc/php-manual-en/gupnp.binary-light.html
    • /usr/share/doc/php-manual-en/gupnp.browsing.html
    • /usr/share/doc/php-manual-en/gupnp.configuration.html
    • /usr/share/doc/php-manual-en/gupnp.constants.html
    • /usr/share/doc/php-manual-en/gupnp.examples.html
    • /usr/share/doc/php-manual-en/gupnp.installation.html
    • /usr/share/doc/php-manual-en/gupnp.requirements.html
    • /usr/share/doc/php-manual-en/gupnp.resources.html
    • /usr/share/doc/php-manual-en/gupnp.setup.html
    • /usr/share/doc/php-manual-en/haru.builtin.encodings.html
    • /usr/share/doc/php-manual-en/haru.builtin.fonts.html
    • /usr/share/doc/php-manual-en/haru.builtin.html
    • /usr/share/doc/php-manual-en/haru.configuration.html
    • /usr/share/doc/php-manual-en/haru.constants.html
    • /usr/share/doc/php-manual-en/haru.examples-basics.html
    • /usr/share/doc/php-manual-en/haru.examples.html
    • /usr/share/doc/php-manual-en/haru.installation.html
    • /usr/share/doc/php-manual-en/haru.requirements.html
    • /usr/share/doc/php-manual-en/haru.resources.html
    • /usr/share/doc/php-manual-en/haru.setup.html
    • /usr/share/doc/php-manual-en/haruannotation.setborderstyle.html
    • /usr/share/doc/php-manual-en/haruannotation.sethighlightmode.html
    • /usr/share/doc/php-manual-en/haruannotation.seticon.html
    • /usr/share/doc/php-manual-en/haruannotation.setopened.html
    • /usr/share/doc/php-manual-en/harudestination.setfit.html
    • /usr/share/doc/php-manual-en/harudestination.setfitb.html
    • /usr/share/doc/php-manual-en/harudestination.setfitbh.html
    • /usr/share/doc/php-manual-en/harudestination.setfitbv.html
    • /usr/share/doc/php-manual-en/harudestination.setfith.html
    • /usr/share/doc/php-manual-en/harudestination.setfitr.html
    • /usr/share/doc/php-manual-en/harudestination.setfitv.html
    • /usr/share/doc/php-manual-en/harudestination.setxyz.html
    • /usr/share/doc/php-manual-en/harudoc.addpage.html
    • /usr/share/doc/php-manual-en/harudoc.addpagelabel.html
    • /usr/share/doc/php-manual-en/harudoc.construct.html
    • /usr/share/doc/php-manual-en/harudoc.createoutline.html
    • /usr/share/doc/php-manual-en/harudoc.getcurrentencoder.html
    • /usr/share/doc/php-manual-en/harudoc.getcurrentpage.html
    • /usr/share/doc/php-manual-en/harudoc.getencoder.html
    • /usr/share/doc/php-manual-en/harudoc.getfont.html
    • /usr/share/doc/php-manual-en/harudoc.getinfoattr.html
    • /usr/share/doc/php-manual-en/harudoc.getpagelayout.html
    • /usr/share/doc/php-manual-en/harudoc.getpagemode.html
    • /usr/share/doc/php-manual-en/harudoc.getstreamsize.html
    • /usr/share/doc/php-manual-en/harudoc.insertpage.html
    • /usr/share/doc/php-manual-en/harudoc.loadjpeg.html
    • /usr/share/doc/php-manual-en/harudoc.loadpng.html
    • /usr/share/doc/php-manual-en/harudoc.loadraw.html
    • /usr/share/doc/php-manual-en/harudoc.loadttc.html
    • /usr/share/doc/php-manual-en/harudoc.loadttf.html
    • /usr/share/doc/php-manual-en/harudoc.loadtype1.html
    • /usr/share/doc/php-manual-en/harudoc.output.html
    • /usr/share/doc/php-manual-en/harudoc.readfromstream.html
    • /usr/share/doc/php-manual-en/harudoc.reseterror.html
    • /usr/share/doc/php-manual-en/harudoc.resetstream.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/harudoc.savetostream.html
    • /usr/share/doc/php-manual-en/harudoc.setcompressionmode.html
    • /usr/share/doc/php-manual-en/harudoc.setcurrentencoder.html
    • /usr/share/doc/php-manual-en/harudoc.setencryptionmode.html
    • /usr/share/doc/php-manual-en/harudoc.setinfoattr.html
    • /usr/share/doc/php-manual-en/harudoc.setinfodateattr.html
    • /usr/share/doc/php-manual-en/harudoc.setopenaction.html
    • /usr/share/doc/php-manual-en/harudoc.setpagelayout.html
    • /usr/share/doc/php-manual-en/harudoc.setpagemode.html
    • /usr/share/doc/php-manual-en/harudoc.setpagesconfiguration.html
    • /usr/share/doc/php-manual-en/harudoc.setpassword.html
    • /usr/share/doc/php-manual-en/harudoc.setpermission.html
    • /usr/share/doc/php-manual-en/harudoc.usecnsencodings.html
    • /usr/share/doc/php-manual-en/harudoc.usecnsfonts.html
    • /usr/share/doc/php-manual-en/harudoc.usecntencodings.html
    • /usr/share/doc/php-manual-en/harudoc.usecntfonts.html
    • /usr/share/doc/php-manual-en/harudoc.usejpencodings.html
    • /usr/share/doc/php-manual-en/harudoc.usejpfonts.html
    • /usr/share/doc/php-manual-en/harudoc.usekrencodings.html
    • /usr/share/doc/php-manual-en/harudoc.usekrfonts.html
    • /usr/share/doc/php-manual-en/haruencoder.getbytetype.html
    • /usr/share/doc/php-manual-en/haruencoder.gettype.html
    • /usr/share/doc/php-manual-en/haruencoder.getunicode.html
    • /usr/share/doc/php-manual-en/haruencoder.getwritingmode.html
    • /usr/share/doc/php-manual-en/harufont.getascent.html
    • /usr/share/doc/php-manual-en/harufont.getcapheight.html
    • /usr/share/doc/php-manual-en/harufont.getdescent.html
    • /usr/share/doc/php-manual-en/harufont.getencodingname.html
    • /usr/share/doc/php-manual-en/harufont.getfontname.html
    • /usr/share/doc/php-manual-en/harufont.gettextwidth.html
    • /usr/share/doc/php-manual-en/harufont.getunicodewidth.html
    • /usr/share/doc/php-manual-en/harufont.getxheight.html
    • /usr/share/doc/php-manual-en/harufont.measuretext.html
    • /usr/share/doc/php-manual-en/haruimage.getbitspercomponent.html
    • /usr/share/doc/php-manual-en/haruimage.getcolorspace.html
    • /usr/share/doc/php-manual-en/haruimage.getheight.html
    • /usr/share/doc/php-manual-en/haruimage.getsize.html
    • /usr/share/doc/php-manual-en/haruimage.getwidth.html
    • /usr/share/doc/php-manual-en/haruimage.setcolormask.html
    • /usr/share/doc/php-manual-en/haruimage.setmaskimage.html
    • /usr/share/doc/php-manual-en/haruoutline.setdestination.html
    • /usr/share/doc/php-manual-en/haruoutline.setopened.html
    • /usr/share/doc/php-manual-en/harupage.arc.html
    • /usr/share/doc/php-manual-en/harupage.begintext.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/harupage.closepath.html
    • /usr/share/doc/php-manual-en/harupage.concat.html
    • /usr/share/doc/php-manual-en/harupage.createdestination.html
    • /usr/share/doc/php-manual-en/harupage.createlinkannotation.html
    • /usr/share/doc/php-manual-en/harupage.createtextannotation.html
    • /usr/share/doc/php-manual-en/harupage.createurlannotation.html
    • /usr/share/doc/php-manual-en/harupage.curveto.html
    • /usr/share/doc/php-manual-en/harupage.curveto2.html
    • /usr/share/doc/php-manual-en/harupage.curveto3.html
    • /usr/share/doc/php-manual-en/harupage.drawimage.html
    • /usr/share/doc/php-manual-en/harupage.ellipse.html
    • /usr/share/doc/php-manual-en/harupage.endpath.html
    • /usr/share/doc/php-manual-en/harupage.endtext.html
    • /usr/share/doc/php-manual-en/harupage.eofill.html
    • /usr/share/doc/php-manual-en/harupage.eofillstroke.html
    • /usr/share/doc/php-manual-en/harupage.fill.html
    • /usr/share/doc/php-manual-en/harupage.fillstroke.html
    • /usr/share/doc/php-manual-en/harupage.getcharspace.html
    • /usr/share/doc/php-manual-en/harupage.getcmykfill.html
    • /usr/share/doc/php-manual-en/harupage.getcmykstroke.html
    • /usr/share/doc/php-manual-en/harupage.getcurrentfont.html
    • /usr/share/doc/php-manual-en/harupage.getcurrentfontsize.html
    • /usr/share/doc/php-manual-en/harupage.getcurrentpos.html
    • /usr/share/doc/php-manual-en/harupage.getcurrenttextpos.html
    • /usr/share/doc/php-manual-en/harupage.getdash.html
    • /usr/share/doc/php-manual-en/harupage.getfillingcolorspace.html
    • /usr/share/doc/php-manual-en/harupage.getflatness.html
    • /usr/share/doc/php-manual-en/harupage.getgmode.html
    • /usr/share/doc/php-manual-en/harupage.getgrayfill.html
    • /usr/share/doc/php-manual-en/harupage.getgraystroke.html
    • /usr/share/doc/php-manual-en/harupage.getheight.html
    • /usr/share/doc/php-manual-en/harupage.gethorizontalscaling.html
    • /usr/share/doc/php-manual-en/harupage.getlinecap.html
    • /usr/share/doc/php-manual-en/harupage.getlinejoin.html
    • /usr/share/doc/php-manual-en/harupage.getlinewidth.html
    • /usr/share/doc/php-manual-en/harupage.getmiterlimit.html
    • /usr/share/doc/php-manual-en/harupage.getrgbfill.html
    • /usr/share/doc/php-manual-en/harupage.getrgbstroke.html
    • /usr/share/doc/php-manual-en/harupage.getstrokingcolorspace.html
    • /usr/share/doc/php-manual-en/harupage.gettextleading.html
    • /usr/share/doc/php-manual-en/harupage.gettextmatrix.html
    • /usr/share/doc/php-manual-en/harupage.gettextrenderingmode.html
    • /usr/share/doc/php-manual-en/harupage.gettextrise.html
    • /usr/share/doc/php-manual-en/harupage.gettextwidth.html
    • /usr/share/doc/php-manual-en/harupage.gettransmatrix.html
    • /usr/share/doc/php-manual-en/harupage.getwidth.html
    • /usr/share/doc/php-manual-en/harupage.getwordspace.html
    • /usr/share/doc/php-manual-en/harupage.lineto.html
    • /usr/share/doc/php-manual-en/harupage.measuretext.html
    • /usr/share/doc/php-manual-en/harupage.movetextpos.html
    • /usr/share/doc/php-manual-en/harupage.moveto.html
    • /usr/share/doc/php-manual-en/harupage.movetonextline.html
    • /usr/share/doc/php-manual-en/harupage.rectangle.html
    • /usr/share/doc/php-manual-en/harupage.setcharspace.html
    • /usr/share/doc/php-manual-en/harupage.setcmykfill.html
    • /usr/share/doc/php-manual-en/harupage.setcmykstroke.html
    • /usr/share/doc/php-manual-en/harupage.setdash.html
    • /usr/share/doc/php-manual-en/harupage.setflatness.html
    • /usr/share/doc/php-manual-en/harupage.setfontandsize.html
    • /usr/share/doc/php-manual-en/harupage.setgrayfill.html
    • /usr/share/doc/php-manual-en/harupage.setgraystroke.html
    • /usr/share/doc/php-manual-en/harupage.setheight.html
    • /usr/share/doc/php-manual-en/harupage.sethorizontalscaling.html
    • /usr/share/doc/php-manual-en/harupage.setlinecap.html
    • /usr/share/doc/php-manual-en/harupage.setlinejoin.html
    • /usr/share/doc/php-manual-en/harupage.setlinewidth.html
    • /usr/share/doc/php-manual-en/harupage.setmiterlimit.html
    • /usr/share/doc/php-manual-en/harupage.setrgbfill.html
    • /usr/share/doc/php-manual-en/harupage.setrgbstroke.html
    • /usr/share/doc/php-manual-en/harupage.setrotate.html
    • /usr/share/doc/php-manual-en/harupage.setsize.html
    • /usr/share/doc/php-manual-en/harupage.setslideshow.html
    • /usr/share/doc/php-manual-en/harupage.settextleading.html
    • /usr/share/doc/php-manual-en/harupage.settextmatrix.html
    • /usr/share/doc/php-manual-en/harupage.settextrenderingmode.html
    • /usr/share/doc/php-manual-en/harupage.settextrise.html
    • /usr/share/doc/php-manual-en/harupage.setwidth.html
    • /usr/share/doc/php-manual-en/harupage.setwordspace.html
    • /usr/share/doc/php-manual-en/harupage.showtext.html
    • /usr/share/doc/php-manual-en/harupage.showtextnextline.html
    • /usr/share/doc/php-manual-en/harupage.stroke.html
    • /usr/share/doc/php-manual-en/harupage.textout.html
    • /usr/share/doc/php-manual-en/harupage.textrect.html
    • /usr/share/doc/php-manual-en/hash.configuration.html
    • /usr/share/doc/php-manual-en/hash.constants.html
    • /usr/share/doc/php-manual-en/hash.installation.html
    • /usr/share/doc/php-manual-en/hash.requirements.html
    • /usr/share/doc/php-manual-en/hash.resources.html
    • /usr/share/doc/php-manual-en/hash.setup.html
    • /usr/share/doc/php-manual-en/history.html
    • /usr/share/doc/php-manual-en/history.php.books.html
    • /usr/share/doc/php-manual-en/history.php.html
    • /usr/share/doc/php-manual-en/history.php.publications.html
    • /usr/share/doc/php-manual-en/history.php.related.html
    • /usr/share/doc/php-manual-en/htscanner.configuration.html
    • /usr/share/doc/php-manual-en/htscanner.installation.html
    • /usr/share/doc/php-manual-en/htscanner.requirements.html
    • /usr/share/doc/php-manual-en/htscanner.resources.html
    • /usr/share/doc/php-manual-en/htscanner.setup.html
    • /usr/share/doc/php-manual-en/http.configuration.html
    • /usr/share/doc/php-manual-en/http.constants.html
    • /usr/share/doc/php-manual-en/http.install.html
    • /usr/share/doc/php-manual-en/http.request.options.html
    • /usr/share/doc/php-manual-en/http.requirements.html
    • /usr/share/doc/php-manual-en/http.resources.html
    • /usr/share/doc/php-manual-en/http.setup.html
    • /usr/share/doc/php-manual-en/httpdeflatestream.construct.html
    • /usr/share/doc/php-manual-en/httpdeflatestream.factory.html
    • /usr/share/doc/php-manual-en/httpdeflatestream.finish.html
    • /usr/share/doc/php-manual-en/httpdeflatestream.flush.html
    • /usr/share/doc/php-manual-en/httpdeflatestream.update.html
    • /usr/share/doc/php-manual-en/httpinflatestream.construct.html
    • /usr/share/doc/php-manual-en/httpinflatestream.factory.html
    • /usr/share/doc/php-manual-en/httpinflatestream.finish.html
    • /usr/share/doc/php-manual-en/httpinflatestream.flush.html
    • /usr/share/doc/php-manual-en/httpinflatestream.update.html
    • /usr/share/doc/php-manual-en/httpmessage.addheaders.html
    • /usr/share/doc/php-manual-en/httpmessage.construct.html
    • /usr/share/doc/php-manual-en/httpmessage.detach.html
    • /usr/share/doc/php-manual-en/httpmessage.factory.html
    • /usr/share/doc/php-manual-en/httpmessage.fromenv.html
    • /usr/share/doc/php-manual-en/httpmessage.fromstring.html
    • /usr/share/doc/php-manual-en/httpmessage.getbody.html
    • /usr/share/doc/php-manual-en/httpmessage.getheader.html
    • /usr/share/doc/php-manual-en/httpmessage.getheaders.html
    • /usr/share/doc/php-manual-en/httpmessage.gethttpversion.html
    • /usr/share/doc/php-manual-en/httpmessage.getparentmessage.html
    • /usr/share/doc/php-manual-en/httpmessage.getrequestmethod.html
    • /usr/share/doc/php-manual-en/httpmessage.getrequesturl.html
    • /usr/share/doc/php-manual-en/httpmessage.getresponsecode.html
    • /usr/share/doc/php-manual-en/httpmessage.getresponsestatus.html
    • /usr/share/doc/php-manual-en/httpmessage.gettype.html
    • /usr/share/doc/php-manual-en/httpmessage.guesscontenttype.html
    • /usr/share/doc/php-manual-en/httpmessage.prepend.html
    • /usr/share/doc/php-manual-en/httpmessage.reverse.html
    • /usr/share/doc/php-manual-en/httpmessage.send.html
    • /usr/share/doc/php-manual-en/httpmessage.setbody.html
    • /usr/share/doc/php-manual-en/httpmessage.setheaders.html
    • /usr/share/doc/php-manual-en/httpmessage.sethttpversion.html
    • /usr/share/doc/php-manual-en/httpmessage.setrequestmethod.html
    • /usr/share/doc/php-manual-en/httpmessage.setrequesturl.html
    • /usr/share/doc/php-manual-en/httpmessage.setresponsecode.html
    • /usr/share/doc/php-manual-en/httpmessage.setresponsestatus.html
    • /usr/share/doc/php-manual-en/httpmessage.settype.html
    • /usr/share/doc/php-manual-en/httpmessage.tomessagetypeobject.html
    • /usr/share/doc/php-manual-en/httpmessage.tostring.html
    • /usr/share/doc/php-manual-en/httpquerystring.construct.html
    • /usr/share/doc/php-manual-en/httpquerystring.get.html
    • /usr/share/doc/php-manual-en/httpquerystring.mod.html
    • /usr/share/doc/php-manual-en/httpquerystring.set.html
    • /usr/share/doc/php-manual-en/httpquerystring.singleton.html
    • /usr/share/doc/php-manual-en/httpquerystring.toarray.html
    • /usr/share/doc/php-manual-en/httpquerystring.tostring.html
    • /usr/share/doc/php-manual-en/httpquerystring.xlate.html
    • /usr/share/doc/php-manual-en/httprequest.addcookies.html
    • /usr/share/doc/php-manual-en/httprequest.addheaders.html
    • /usr/share/doc/php-manual-en/httprequest.addpostfields.html
    • /usr/share/doc/php-manual-en/httprequest.addpostfile.html
    • /usr/share/doc/php-manual-en/httprequest.addputdata.html
    • /usr/share/doc/php-manual-en/httprequest.addquerydata.html
    • /usr/share/doc/php-manual-en/httprequest.addrawpostdata.html
    • /usr/share/doc/php-manual-en/httprequest.addssloptions.html
    • /usr/share/doc/php-manual-en/httprequest.clearhistory.html
    • /usr/share/doc/php-manual-en/httprequest.construct.html
    • /usr/share/doc/php-manual-en/httprequest.enablecookies.html
    • /usr/share/doc/php-manual-en/httprequest.getcontenttype.html
    • /usr/share/doc/php-manual-en/httprequest.getcookies.html
    • /usr/share/doc/php-manual-en/httprequest.getheaders.html
    • /usr/share/doc/php-manual-en/httprequest.gethistory.html
    • /usr/share/doc/php-manual-en/httprequest.getmethod.html
    • /usr/share/doc/php-manual-en/httprequest.getoptions.html
    • /usr/share/doc/php-manual-en/httprequest.getpostfields.html
    • /usr/share/doc/php-manual-en/httprequest.getpostfiles.html
    • /usr/share/doc/php-manual-en/httprequest.getputdata.html
    • /usr/share/doc/php-manual-en/httprequest.getputfile.html
    • /usr/share/doc/php-manual-en/httprequest.getquerydata.html
    • /usr/share/doc/php-manual-en/httprequest.getrawpostdata.html
    • /usr/share/doc/php-manual-en/httprequest.getrawrequestmessage.html
    • /usr/share/doc/php-manual-en/httprequest.getrawresponsemessage.html
    • /usr/share/doc/php-manual-en/httprequest.getrequestmessage.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsebody.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsecode.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsecookies.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsedata.html
    • /usr/share/doc/php-manual-en/httprequest.getresponseheader.html
    • /usr/share/doc/php-manual-en/httprequest.getresponseinfo.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsemessage.html
    • /usr/share/doc/php-manual-en/httprequest.getresponsestatus.html
    • /usr/share/doc/php-manual-en/httprequest.getssloptions.html
    • /usr/share/doc/php-manual-en/httprequest.geturl.html
    • /usr/share/doc/php-manual-en/httprequest.resetcookies.html
    • /usr/share/doc/php-manual-en/httprequest.send.html
    • /usr/share/doc/php-manual-en/httprequest.setbody.html
    • /usr/share/doc/php-manual-en/httprequest.setcontenttype.html
    • /usr/share/doc/php-manual-en/httprequest.setcookies.html
    • /usr/share/doc/php-manual-en/httprequest.setheaders.html
    • /usr/share/doc/php-manual-en/httprequest.setmethod.html
    • /usr/share/doc/php-manual-en/httprequest.setoptions.html
    • /usr/share/doc/php-manual-en/httprequest.setpostfields.html
    • /usr/share/doc/php-manual-en/httprequest.setpostfiles.html
    • /usr/share/doc/php-manual-en/httprequest.setputdata.html
    • /usr/share/doc/php-manual-en/httprequest.setputfile.html
    • /usr/share/doc/php-manual-en/httprequest.setquerydata.html
    • /usr/share/doc/php-manual-en/httprequest.setrawpostdata.html
    • /usr/share/doc/php-manual-en/httprequest.setssloptions.html
    • /usr/share/doc/php-manual-en/httprequest.seturl.html
    • /usr/share/doc/php-manual-en/httprequestpool.attach.html
    • /usr/share/doc/php-manual-en/httprequestpool.construct.html
    • /usr/share/doc/php-manual-en/httprequestpool.destruct.html
    • /usr/share/doc/php-manual-en/httprequestpool.detach.html
    • /usr/share/doc/php-manual-en/httprequestpool.getattachedrequests.html
    • /usr/share/doc/php-manual-en/httprequestpool.getfinishedrequests.html
    • /usr/share/doc/php-manual-en/httprequestpool.reset.html
    • /usr/share/doc/php-manual-en/httprequestpool.send.html
    • /usr/share/doc/php-manual-en/httprequestpool.socketperform.html
    • /usr/share/doc/php-manual-en/httprequestpool.socketselect.html
    • /usr/share/doc/php-manual-en/httpresponse.capture.html
    • /usr/share/doc/php-manual-en/httpresponse.getbuffersize.html
    • /usr/share/doc/php-manual-en/httpresponse.getcache.html
    • /usr/share/doc/php-manual-en/httpresponse.getcachecontrol.html
    • /usr/share/doc/php-manual-en/httpresponse.getcontentdisposition.html
    • /usr/share/doc/php-manual-en/httpresponse.getcontenttype.html
    • /usr/share/doc/php-manual-en/httpresponse.getdata.html
    • /usr/share/doc/php-manual-en/httpresponse.getetag.html
    • /usr/share/doc/php-manual-en/httpresponse.getfile.html
    • /usr/share/doc/php-manual-en/httpresponse.getgzip.html
    • /usr/share/doc/php-manual-en/httpresponse.getheader.html
    • /usr/share/doc/php-manual-en/httpresponse.getlastmodified.html
    • /usr/share/doc/php-manual-en/httpresponse.getrequestbody.html
    • /usr/share/doc/php-manual-en/httpresponse.getrequestbodystream.html
    • /usr/share/doc/php-manual-en/httpresponse.getrequestheaders.html
    • /usr/share/doc/php-manual-en/httpresponse.getstream.html
    • /usr/share/doc/php-manual-en/httpresponse.getthrottledelay.html
    • /usr/share/doc/php-manual-en/httpresponse.guesscontenttype.html
    • /usr/share/doc/php-manual-en/httpresponse.redirect.html
    • /usr/share/doc/php-manual-en/httpresponse.send.html
    • /usr/share/doc/php-manual-en/httpresponse.setbuffersize.html
    • /usr/share/doc/php-manual-en/httpresponse.setcache.html
    • /usr/share/doc/php-manual-en/httpresponse.setcachecontrol.html
    • /usr/share/doc/php-manual-en/httpresponse.setcontentdisposition.html
    • /usr/share/doc/php-manual-en/httpresponse.setcontenttype.html
    • /usr/share/doc/php-manual-en/httpresponse.setdata.html
    • /usr/share/doc/php-manual-en/httpresponse.setetag.html
    • /usr/share/doc/php-manual-en/httpresponse.setfile.html
    • /usr/share/doc/php-manual-en/httpresponse.setgzip.html
    • /usr/share/doc/php-manual-en/httpresponse.setheader.html
    • /usr/share/doc/php-manual-en/httpresponse.setlastmodified.html
    • /usr/share/doc/php-manual-en/httpresponse.setstream.html
    • /usr/share/doc/php-manual-en/httpresponse.setthrottledelay.html
    • /usr/share/doc/php-manual-en/httpresponse.status.html
    • /usr/share/doc/php-manual-en/hw.apache.html
    • /usr/share/doc/php-manual-en/hw.configuration.html
    • /usr/share/doc/php-manual-en/hw.constants.html
    • /usr/share/doc/php-manual-en/hw.installation.html
    • /usr/share/doc/php-manual-en/hw.requirements.html
    • /usr/share/doc/php-manual-en/hw.resources.html
    • /usr/share/doc/php-manual-en/hw.setup.html
    • /usr/share/doc/php-manual-en/hwapi.attribute-key.html
    • /usr/share/doc/php-manual-en/hwapi.attribute-langdepvalue.html
    • /usr/share/doc/php-manual-en/hwapi.attribute-value.html
    • /usr/share/doc/php-manual-en/hwapi.attribute-values.html
    • /usr/share/doc/php-manual-en/hwapi.checkin.html
    • /usr/share/doc/php-manual-en/hwapi.checkout.html
    • /usr/share/doc/php-manual-en/hwapi.children.html
    • /usr/share/doc/php-manual-en/hwapi.configuration.html
    • /usr/share/doc/php-manual-en/hwapi.constants.html
    • /usr/share/doc/php-manual-en/hwapi.content-mimetype.html
    • /usr/share/doc/php-manual-en/hwapi.content-read.html
    • /usr/share/doc/php-manual-en/hwapi.content.html
    • /usr/share/doc/php-manual-en/hwapi.copy.html
    • /usr/share/doc/php-manual-en/hwapi.dbstat.html
    • /usr/share/doc/php-manual-en/hwapi.dcstat.html
    • /usr/share/doc/php-manual-en/hwapi.dstanchors.html
    • /usr/share/doc/php-manual-en/hwapi.dstofsrcanchor.html
    • /usr/share/doc/php-manual-en/hwapi.error-count.html
    • /usr/share/doc/php-manual-en/hwapi.error-reason.html
    • /usr/share/doc/php-manual-en/hwapi.find.html
    • /usr/share/doc/php-manual-en/hwapi.ftstat.html
    • /usr/share/doc/php-manual-en/hwapi.hwstat.html
    • /usr/share/doc/php-manual-en/hwapi.identify.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/hwapi.insert.html
    • /usr/share/doc/php-manual-en/hwapi.insertanchor.html
    • /usr/share/doc/php-manual-en/hwapi.insertcollection.html
    • /usr/share/doc/php-manual-en/hwapi.insertdocument.html
    • /usr/share/doc/php-manual-en/hwapi.installation.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/hwapi.lock.html
    • /usr/share/doc/php-manual-en/hwapi.move.html
    • /usr/share/doc/php-manual-en/hwapi.object-assign.html
    • /usr/share/doc/php-manual-en/hwapi.object-attreditable.html
    • /usr/share/doc/php-manual-en/hwapi.object-count.html
    • /usr/share/doc/php-manual-en/hwapi.object-insert.html
    • /usr/share/doc/php-manual-en/hwapi.object-remove.html
    • /usr/share/doc/php-manual-en/hwapi.object-title.html
    • /usr/share/doc/php-manual-en/hwapi.object-value.html
    • /usr/share/doc/php-manual-en/hwapi.object.html
    • /usr/share/doc/php-manual-en/hwapi.objectbyanchor.html
    • /usr/share/doc/php-manual-en/hwapi.parents.html
    • /usr/share/doc/php-manual-en/hwapi.reason-description.html
    • /usr/share/doc/php-manual-en/hwapi.reason-type.html
    • /usr/share/doc/php-manual-en/hwapi.remove.html
    • /usr/share/doc/php-manual-en/hwapi.replace.html
    • /usr/share/doc/php-manual-en/hwapi.requirements.html
    • /usr/share/doc/php-manual-en/hwapi.resources.html
    • /usr/share/doc/php-manual-en/hwapi.setcommittedversion.html
    • /usr/share/doc/php-manual-en/hwapi.setup.html
    • /usr/share/doc/php-manual-en/hwapi.srcanchors.html
    • /usr/share/doc/php-manual-en/hwapi.srcsofdst.html
    • /usr/share/doc/php-manual-en/hwapi.unlock.html
    • /usr/share/doc/php-manual-en/hwapi.user.html
    • /usr/share/doc/php-manual-en/hwapi.userlist.html
    • /usr/share/doc/php-manual-en/ibase.configuration.html
    • /usr/share/doc/php-manual-en/ibase.constants.html
    • /usr/share/doc/php-manual-en/ibase.installation.html
    • /usr/share/doc/php-manual-en/ibase.requirements.html
    • /usr/share/doc/php-manual-en/ibase.resources.html
    • /usr/share/doc/php-manual-en/ibase.setup.html
    • /usr/share/doc/php-manual-en/ibm-db2.configuration.html
    • /usr/share/doc/php-manual-en/ibm-db2.constants.html
    • /usr/share/doc/php-manual-en/ibm-db2.installation.html
    • /usr/share/doc/php-manual-en/ibm-db2.requirements.html
    • /usr/share/doc/php-manual-en/ibm-db2.resources.html
    • /usr/share/doc/php-manual-en/ibm-db2.setup.html
    • /usr/share/doc/php-manual-en/iconv.configuration.html
    • /usr/share/doc/php-manual-en/iconv.constants.html
    • /usr/share/doc/php-manual-en/iconv.installation.html
    • /usr/share/doc/php-manual-en/iconv.requirements.html
    • /usr/share/doc/php-manual-en/iconv.resources.html
    • /usr/share/doc/php-manual-en/iconv.setup.html
    • /usr/share/doc/php-manual-en/id3.configuration.html
    • /usr/share/doc/php-manual-en/id3.constants.html
    • /usr/share/doc/php-manual-en/id3.installation.html
    • /usr/share/doc/php-manual-en/id3.requirements.html
    • /usr/share/doc/php-manual-en/id3.resources.html
    • /usr/share/doc/php-manual-en/id3.setup.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.getdescription.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.getmimetype.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.gettype.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.savepicture.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.setmimetype.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.setpicture.html
    • /usr/share/doc/php-manual-en/id3v2attachedpictureframe.settype.html
    • /usr/share/doc/php-manual-en/id3v2frame.getsize.html
    • /usr/share/doc/php-manual-en/id3v2frame.tostring.html
    • /usr/share/doc/php-manual-en/id3v2tag.addframe.html
    • /usr/share/doc/php-manual-en/id3v2tag.getframelist.html
    • /usr/share/doc/php-manual-en/ifx.configuration.html
    • /usr/share/doc/php-manual-en/ifx.constants.html
    • /usr/share/doc/php-manual-en/ifx.installation.html
    • /usr/share/doc/php-manual-en/ifx.requirements.html
    • /usr/share/doc/php-manual-en/ifx.resources.html
    • /usr/share/doc/php-manual-en/ifx.setup.html
    • /usr/share/doc/php-manual-en/iisfunc.configuration.html
    • /usr/share/doc/php-manual-en/iisfunc.constants.html
    • /usr/share/doc/php-manual-en/iisfunc.installation.html
    • /usr/share/doc/php-manual-en/iisfunc.requirements.html
    • /usr/share/doc/php-manual-en/iisfunc.resources.html
    • /usr/share/doc/php-manual-en/iisfunc.setup.html
    • /usr/share/doc/php-manual-en/image.configuration.html
    • /usr/share/doc/php-manual-en/image.constants.html
    • /usr/share/doc/php-manual-en/image.examples-png.html
    • /usr/share/doc/php-manual-en/image.examples-watermark.html
    • /usr/share/doc/php-manual-en/image.examples.html
    • /usr/share/doc/php-manual-en/image.examples.merged-watermark.html
    • /usr/share/doc/php-manual-en/image.installation.html
    • /usr/share/doc/php-manual-en/image.requirements.html
    • /usr/share/doc/php-manual-en/image.resources.html
    • /usr/share/doc/php-manual-en/image.setup.html
    • /usr/share/doc/php-manual-en/imagick.adaptiveblurimage.html
    • /usr/share/doc/php-manual-en/imagick.adaptiveresizeimage.html
    • /usr/share/doc/php-manual-en/imagick.adaptivesharpenimage.html
    • /usr/share/doc/php-manual-en/imagick.adaptivethresholdimage.html
    • /usr/share/doc/php-manual-en/imagick.addimage.html
    • /usr/share/doc/php-manual-en/imagick.addnoiseimage.html
    • /usr/share/doc/php-manual-en/imagick.affinetransformimage.html
    • /usr/share/doc/php-manual-en/imagick.animateimages.html
    • /usr/share/doc/php-manual-en/imagick.annotateimage.html
    • /usr/share/doc/php-manual-en/imagick.appendimages.html
    • /usr/share/doc/php-manual-en/imagick.averageimages.html
    • /usr/share/doc/php-manual-en/imagick.blackthresholdimage.html
    • /usr/share/doc/php-manual-en/imagick.blurimage.html
    • /usr/share/doc/php-manual-en/imagick.borderimage.html
    • /usr/share/doc/php-manual-en/imagick.charcoalimage.html
    • /usr/share/doc/php-manual-en/imagick.chopimage.html
    • /usr/share/doc/php-manual-en/imagick.clear.html
    • /usr/share/doc/php-manual-en/imagick.clipimage.html
    • /usr/share/doc/php-manual-en/imagick.clippathimage.html
    • /usr/share/doc/php-manual-en/imagick.clone.html
    • /usr/share/doc/php-manual-en/imagick.clutimage.html
    • /usr/share/doc/php-manual-en/imagick.coalesceimages.html
    • /usr/share/doc/php-manual-en/imagick.colorfloodfillimage.html
    • /usr/share/doc/php-manual-en/imagick.colorizeimage.html
    • /usr/share/doc/php-manual-en/imagick.combineimages.html
    • /usr/share/doc/php-manual-en/imagick.commentimage.html
    • /usr/share/doc/php-manual-en/imagick.compareimagechannels.html
    • /usr/share/doc/php-manual-en/imagick.compareimagelayers.html
    • /usr/share/doc/php-manual-en/imagick.compareimages.html
    • /usr/share/doc/php-manual-en/imagick.compositeimage.html
    • /usr/share/doc/php-manual-en/imagick.configuration.html
    • /usr/share/doc/php-manual-en/imagick.constants.html
    • /usr/share/doc/php-manual-en/imagick.construct.html
    • /usr/share/doc/php-manual-en/imagick.contrastimage.html
    • /usr/share/doc/php-manual-en/imagick.contraststretchimage.html
    • /usr/share/doc/php-manual-en/imagick.convolveimage.html
    • /usr/share/doc/php-manual-en/imagick.cropimage.html
    • /usr/share/doc/php-manual-en/imagick.cropthumbnailimage.html
    • /usr/share/doc/php-manual-en/imagick.current.html
    • /usr/share/doc/php-manual-en/imagick.cyclecolormapimage.html
    • /usr/share/doc/php-manual-en/imagick.decipherimage.html
    • /usr/share/doc/php-manual-en/imagick.deconstructimages.html
    • /usr/share/doc/php-manual-en/imagick.deleteimageartifact.html
    • /usr/share/doc/php-manual-en/imagick.deskewimage.html
    • /usr/share/doc/php-manual-en/imagick.despeckleimage.html
    • /usr/share/doc/php-manual-en/imagick.destroy.html
    • /usr/share/doc/php-manual-en/imagick.displayimage.html
    • /usr/share/doc/php-manual-en/imagick.displayimages.html
    • /usr/share/doc/php-manual-en/imagick.distortimage.html
    • /usr/share/doc/php-manual-en/imagick.drawimage.html
    • /usr/share/doc/php-manual-en/imagick.edgeimage.html
    • /usr/share/doc/php-manual-en/imagick.embossimage.html
    • /usr/share/doc/php-manual-en/imagick.encipherimage.html
    • /usr/share/doc/php-manual-en/imagick.enhanceimage.html
    • /usr/share/doc/php-manual-en/imagick.equalizeimage.html
    • /usr/share/doc/php-manual-en/imagick.evaluateimage.html
    • /usr/share/doc/php-manual-en/imagick.examples-1.html
    • /usr/share/doc/php-manual-en/imagick.examples.html
    • /usr/share/doc/php-manual-en/imagick.exportimagepixels.html
    • /usr/share/doc/php-manual-en/imagick.extentimage.html
    • /usr/share/doc/php-manual-en/imagick.flattenimages.html
    • /usr/share/doc/php-manual-en/imagick.flipimage.html
    • /usr/share/doc/php-manual-en/imagick.floodfillpaintimage.html
    • /usr/share/doc/php-manual-en/imagick.flopimage.html
    • /usr/share/doc/php-manual-en/imagick.frameimage.html
    • /usr/share/doc/php-manual-en/imagick.functionimage.html
    • /usr/share/doc/php-manual-en/imagick.fximage.html
    • /usr/share/doc/php-manual-en/imagick.gammaimage.html
    • /usr/share/doc/php-manual-en/imagick.gaussianblurimage.html
    • /usr/share/doc/php-manual-en/imagick.getcolorspace.html
    • /usr/share/doc/php-manual-en/imagick.getcompression.html
    • /usr/share/doc/php-manual-en/imagick.getcompressionquality.html
    • /usr/share/doc/php-manual-en/imagick.getcopyright.html
    • /usr/share/doc/php-manual-en/imagick.getfilename.html
    • /usr/share/doc/php-manual-en/imagick.getfont.html
    • /usr/share/doc/php-manual-en/imagick.getformat.html
    • /usr/share/doc/php-manual-en/imagick.getgravity.html
    • /usr/share/doc/php-manual-en/imagick.gethomeurl.html
    • /usr/share/doc/php-manual-en/imagick.getimage.html
    • /usr/share/doc/php-manual-en/imagick.getimagealphachannel.html
    • /usr/share/doc/php-manual-en/imagick.getimageartifact.html
    • /usr/share/doc/php-manual-en/imagick.getimagebackgroundcolor.html
    • /usr/share/doc/php-manual-en/imagick.getimageblob.html
    • /usr/share/doc/php-manual-en/imagick.getimageblueprimary.html
    • /usr/share/doc/php-manual-en/imagick.getimagebordercolor.html
    • /usr/share/doc/php-manual-en/imagick.getimagechanneldepth.html
    • /usr/share/doc/php-manual-en/imagick.getimagechanneldistortion.html
    • /usr/share/doc/php-manual-en/imagick.getimagechanneldistortions.html
    • /usr/share/doc/php-manual-en/imagick.getimagechannelextrema.html
    • /usr/share/doc/php-manual-en/imagick.getimagechannelkurtosis.html
    • /usr/share/doc/php-manual-en/imagick.getimagechannelmean.html
    • /usr/share/doc/php-manual-en/imagick.getimagechannelrange.html
    • /usr/share/doc/php-manual-en/imagick.getimagechannelstatistics.html
    • /usr/share/doc/php-manual-en/imagick.getimageclipmask.html
    • /usr/share/doc/php-manual-en/imagick.getimagecolormapcolor.html
    • /usr/share/doc/php-manual-en/imagick.getimagecolors.html
    • /usr/share/doc/php-manual-en/imagick.getimagecolorspace.html
    • /usr/share/doc/php-manual-en/imagick.getimagecompose.html
    • /usr/share/doc/php-manual-en/imagick.getimagecompression.html
    • /usr/share/doc/php-manual-en/imagick.getimagecompressionquality.html
    • /usr/share/doc/php-manual-en/imagick.getimagedelay.html
    • /usr/share/doc/php-manual-en/imagick.getimagedepth.html
    • /usr/share/doc/php-manual-en/imagick.getimagedispose.html
    • /usr/share/doc/php-manual-en/imagick.getimagedistortion.html
    • /usr/share/doc/php-manual-en/imagick.getimageextrema.html
    • /usr/share/doc/php-manual-en/imagick.getimagefilename.html
    • /usr/share/doc/php-manual-en/imagick.getimageformat.html
    • /usr/share/doc/php-manual-en/imagick.getimagegamma.html
    • /usr/share/doc/php-manual-en/imagick.getimagegeometry.html
    • /usr/share/doc/php-manual-en/imagick.getimagegravity.html
    • /usr/share/doc/php-manual-en/imagick.getimagegreenprimary.html
    • /usr/share/doc/php-manual-en/imagick.getimageheight.html
    • /usr/share/doc/php-manual-en/imagick.getimagehistogram.html
    • /usr/share/doc/php-manual-en/imagick.getimageindex.html
    • /usr/share/doc/php-manual-en/imagick.getimageinterlacescheme.html
    • /usr/share/doc/php-manual-en/imagick.getimageinterpolatemethod.html
    • /usr/share/doc/php-manual-en/imagick.getimageiterations.html
    • /usr/share/doc/php-manual-en/imagick.getimagelength.html
    • /usr/share/doc/php-manual-en/imagick.getimagemagicklicense.html
    • /usr/share/doc/php-manual-en/imagick.getimagematte.html
    • /usr/share/doc/php-manual-en/imagick.getimagemattecolor.html
    • /usr/share/doc/php-manual-en/imagick.getimageorientation.html
    • /usr/share/doc/php-manual-en/imagick.getimagepage.html
    • /usr/share/doc/php-manual-en/imagick.getimagepixelcolor.html
    • /usr/share/doc/php-manual-en/imagick.getimageprofile.html
    • /usr/share/doc/php-manual-en/imagick.getimageprofiles.html
    • /usr/share/doc/php-manual-en/imagick.getimageproperties.html
    • /usr/share/doc/php-manual-en/imagick.getimageproperty.html
    • /usr/share/doc/php-manual-en/imagick.getimageredprimary.html
    • /usr/share/doc/php-manual-en/imagick.getimageregion.html
    • /usr/share/doc/php-manual-en/imagick.getimagerenderingintent.html
    • /usr/share/doc/php-manual-en/imagick.getimageresolution.html
    • /usr/share/doc/php-manual-en/imagick.getimagesblob.html
    • /usr/share/doc/php-manual-en/imagick.getimagescene.html
    • /usr/share/doc/php-manual-en/imagick.getimagesignature.html
    • /usr/share/doc/php-manual-en/imagick.getimagesize.html
    • /usr/share/doc/php-manual-en/imagick.getimagetickspersecond.html
    • /usr/share/doc/php-manual-en/imagick.getimagetotalinkdensity.html
    • /usr/share/doc/php-manual-en/imagick.getimagetype.html
    • /usr/share/doc/php-manual-en/imagick.getimageunits.html
    • /usr/share/doc/php-manual-en/imagick.getimagevirtualpixelmethod.html
    • /usr/share/doc/php-manual-en/imagick.getimagewhitepoint.html
    • /usr/share/doc/php-manual-en/imagick.getimagewidth.html
    • /usr/share/doc/php-manual-en/imagick.getinterlacescheme.html
    • /usr/share/doc/php-manual-en/imagick.getiteratorindex.html
    • /usr/share/doc/php-manual-en/imagick.getnumberimages.html
    • /usr/share/doc/php-manual-en/imagick.getoption.html
    • /usr/share/doc/php-manual-en/imagick.getpackagename.html
    • /usr/share/doc/php-manual-en/imagick.getpage.html
    • /usr/share/doc/php-manual-en/imagick.getpixeliterator.html
    • /usr/share/doc/php-manual-en/imagick.getpixelregioniterator.html
    • /usr/share/doc/php-manual-en/imagick.getpointsize.html
    • /usr/share/doc/php-manual-en/imagick.getquantumdepth.html
    • /usr/share/doc/php-manual-en/imagick.getquantumrange.html
    • /usr/share/doc/php-manual-en/imagick.getreleasedate.html
    • /usr/share/doc/php-manual-en/imagick.getresource.html
    • /usr/share/doc/php-manual-en/imagick.getresourcelimit.html
    • /usr/share/doc/php-manual-en/imagick.getsamplingfactors.html
    • /usr/share/doc/php-manual-en/imagick.getsize.html
    • /usr/share/doc/php-manual-en/imagick.getsizeoffset.html
    • /usr/share/doc/php-manual-en/imagick.getversion.html
    • /usr/share/doc/php-manual-en/imagick.haldclutimage.html
    • /usr/share/doc/php-manual-en/imagick.hasnextimage.html
    • /usr/share/doc/php-manual-en/imagick.haspreviousimage.html
    • /usr/share/doc/php-manual-en/imagick.identifyimage.html
    • /usr/share/doc/php-manual-en/imagick.implodeimage.html
    • /usr/share/doc/php-manual-en/imagick.importimagepixels.html
    • /usr/share/doc/php-manual-en/imagick.installation.html
    • /usr/share/doc/php-manual-en/imagick.labelimage.html
    • /usr/share/doc/php-manual-en/imagick.levelimage.html
    • /usr/share/doc/php-manual-en/imagick.linearstretchimage.html
    • /usr/share/doc/php-manual-en/imagick.liquidrescaleimage.html
    • /usr/share/doc/php-manual-en/imagick.magnifyimage.html
    • /usr/share/doc/php-manual-en/imagick.mapimage.html
    • /usr/share/doc/php-manual-en/imagick.mattefloodfillimage.html
    • /usr/share/doc/php-manual-en/imagick.medianfilterimage.html
    • /usr/share/doc/php-manual-en/imagick.mergeimagelayers.html
    • /usr/share/doc/php-manual-en/imagick.minifyimage.html
    • /usr/share/doc/php-manual-en/imagick.modulateimage.html
    • /usr/share/doc/php-manual-en/imagick.montageimage.html
    • /usr/share/doc/php-manual-en/imagick.morphimages.html
    • /usr/share/doc/php-manual-en/imagick.mosaicimages.html
    • /usr/share/doc/php-manual-en/imagick.motionblurimage.html
    • /usr/share/doc/php-manual-en/imagick.negateimage.html
    • /usr/share/doc/php-manual-en/imagick.newimage.html
    • /usr/share/doc/php-manual-en/imagick.newpseudoimage.html
    • /usr/share/doc/php-manual-en/imagick.nextimage.html
    • /usr/share/doc/php-manual-en/imagick.normalizeimage.html
    • /usr/share/doc/php-manual-en/imagick.oilpaintimage.html
    • /usr/share/doc/php-manual-en/imagick.opaquepaintimage.html
    • /usr/share/doc/php-manual-en/imagick.optimizeimagelayers.html
    • /usr/share/doc/php-manual-en/imagick.orderedposterizeimage.html
    • /usr/share/doc/php-manual-en/imagick.paintfloodfillimage.html
    • /usr/share/doc/php-manual-en/imagick.paintopaqueimage.html
    • /usr/share/doc/php-manual-en/imagick.painttransparentimage.html
    • /usr/share/doc/php-manual-en/imagick.pingimage.html
    • /usr/share/doc/php-manual-en/imagick.pingimageblob.html
    • /usr/share/doc/php-manual-en/imagick.pingimagefile.html
    • /usr/share/doc/php-manual-en/imagick.polaroidimage.html
    • /usr/share/doc/php-manual-en/imagick.posterizeimage.html
    • /usr/share/doc/php-manual-en/imagick.previewimages.html
    • /usr/share/doc/php-manual-en/imagick.previousimage.html
    • /usr/share/doc/php-manual-en/imagick.profileimage.html
    • /usr/share/doc/php-manual-en/imagick.quantizeimage.html
    • /usr/share/doc/php-manual-en/imagick.quantizeimages.html
    • /usr/share/doc/php-manual-en/imagick.queryfontmetrics.html
    • /usr/share/doc/php-manual-en/imagick.queryfonts.html
    • /usr/share/doc/php-manual-en/imagick.queryformats.html
    • /usr/share/doc/php-manual-en/imagick.radialblurimage.html
    • /usr/share/doc/php-manual-en/imagick.raiseimage.html
    • /usr/share/doc/php-manual-en/imagick.randomthresholdimage.html
    • /usr/share/doc/php-manual-en/imagick.readimage.html
    • /usr/share/doc/php-manual-en/imagick.readimageblob.html
    • /usr/share/doc/php-manual-en/imagick.readimagefile.html
    • /usr/share/doc/php-manual-en/imagick.recolorimage.html
    • /usr/share/doc/php-manual-en/imagick.reducenoiseimage.html
    • /usr/share/doc/php-manual-en/imagick.remapimage.html
    • /usr/share/doc/php-manual-en/imagick.removeimage.html
    • /usr/share/doc/php-manual-en/imagick.removeimageprofile.html
    • /usr/share/doc/php-manual-en/imagick.render.html
    • /usr/share/doc/php-manual-en/imagick.requirements.html
    • /usr/share/doc/php-manual-en/imagick.resampleimage.html
    • /usr/share/doc/php-manual-en/imagick.resetimagepage.html
    • /usr/share/doc/php-manual-en/imagick.resizeimage.html
    • /usr/share/doc/php-manual-en/imagick.resources.html
    • /usr/share/doc/php-manual-en/imagick.rollimage.html
    • /usr/share/doc/php-manual-en/imagick.rotateimage.html
    • /usr/share/doc/php-manual-en/imagick.roundcorners.html
    • /usr/share/doc/php-manual-en/imagick.sampleimage.html
    • /usr/share/doc/php-manual-en/imagick.scaleimage.html
    • /usr/share/doc/php-manual-en/imagick.segmentimage.html
    • /usr/share/doc/php-manual-en/imagick.separateimagechannel.html
    • /usr/share/doc/php-manual-en/imagick.sepiatoneimage.html
    • /usr/share/doc/php-manual-en/imagick.setbackgroundcolor.html
    • /usr/share/doc/php-manual-en/imagick.setcolorspace.html
    • /usr/share/doc/php-manual-en/imagick.setcompression.html
    • /usr/share/doc/php-manual-en/imagick.setcompressionquality.html
    • /usr/share/doc/php-manual-en/imagick.setfilename.html
    • /usr/share/doc/php-manual-en/imagick.setfirstiterator.html
    • /usr/share/doc/php-manual-en/imagick.setfont.html
    • /usr/share/doc/php-manual-en/imagick.setformat.html
    • /usr/share/doc/php-manual-en/imagick.setgravity.html
    • /usr/share/doc/php-manual-en/imagick.setimage.html
    • /usr/share/doc/php-manual-en/imagick.setimagealphachannel.html
    • /usr/share/doc/php-manual-en/imagick.setimageartifact.html
    • /usr/share/doc/php-manual-en/imagick.setimagebackgroundcolor.html
    • /usr/share/doc/php-manual-en/imagick.setimagebias.html
    • /usr/share/doc/php-manual-en/imagick.setimageblueprimary.html
    • /usr/share/doc/php-manual-en/imagick.setimagebordercolor.html
    • /usr/share/doc/php-manual-en/imagick.setimagechanneldepth.html
    • /usr/share/doc/php-manual-en/imagick.setimageclipmask.html
    • /usr/share/doc/php-manual-en/imagick.setimagecolormapcolor.html
    • /usr/share/doc/php-manual-en/imagick.setimagecolorspace.html
    • /usr/share/doc/php-manual-en/imagick.setimagecompose.html
    • /usr/share/doc/php-manual-en/imagick.setimagecompression.html
    • /usr/share/doc/php-manual-en/imagick.setimagecompressionquality.html
    • /usr/share/doc/php-manual-en/imagick.setimagedelay.html
    • /usr/share/doc/php-manual-en/imagick.setimagedepth.html
    • /usr/share/doc/php-manual-en/imagick.setimagedispose.html
    • /usr/share/doc/php-manual-en/imagick.setimageextent.html
    • /usr/share/doc/php-manual-en/imagick.setimagefilename.html
    • /usr/share/doc/php-manual-en/imagick.setimageformat.html
    • /usr/share/doc/php-manual-en/imagick.setimagegamma.html
    • /usr/share/doc/php-manual-en/imagick.setimagegravity.html
    • /usr/share/doc/php-manual-en/imagick.setimagegreenprimary.html
    • /usr/share/doc/php-manual-en/imagick.setimageindex.html
    • /usr/share/doc/php-manual-en/imagick.setimageinterlacescheme.html
    • /usr/share/doc/php-manual-en/imagick.setimageinterpolatemethod.html
    • /usr/share/doc/php-manual-en/imagick.setimageiterations.html
    • /usr/share/doc/php-manual-en/imagick.setimagematte.html
    • /usr/share/doc/php-manual-en/imagick.setimagemattecolor.html
    • /usr/share/doc/php-manual-en/imagick.setimageopacity.html
    • /usr/share/doc/php-manual-en/imagick.setimageorientation.html
    • /usr/share/doc/php-manual-en/imagick.setimagepage.html
    • /usr/share/doc/php-manual-en/imagick.setimageprofile.html
    • /usr/share/doc/php-manual-en/imagick.setimageproperty.html
    • /usr/share/doc/php-manual-en/imagick.setimageredprimary.html
    • /usr/share/doc/php-manual-en/imagick.setimagerenderingintent.html
    • /usr/share/doc/php-manual-en/imagick.setimageresolution.html
    • /usr/share/doc/php-manual-en/imagick.setimagescene.html
    • /usr/share/doc/php-manual-en/imagick.setimagetickspersecond.html
    • /usr/share/doc/php-manual-en/imagick.setimagetype.html
    • /usr/share/doc/php-manual-en/imagick.setimageunits.html
    • /usr/share/doc/php-manual-en/imagick.setimagevirtualpixelmethod.html
    • /usr/share/doc/php-manual-en/imagick.setimagewhitepoint.html
    • /usr/share/doc/php-manual-en/imagick.setinterlacescheme.html
    • /usr/share/doc/php-manual-en/imagick.setiteratorindex.html
    • /usr/share/doc/php-manual-en/imagick.setlastiterator.html
    • /usr/share/doc/php-manual-en/imagick.setoption.html
    • /usr/share/doc/php-manual-en/imagick.setpage.html
    • /usr/share/doc/php-manual-en/imagick.setpointsize.html
    • /usr/share/doc/php-manual-en/imagick.setresolution.html
    • /usr/share/doc/php-manual-en/imagick.setresourcelimit.html
    • /usr/share/doc/php-manual-en/imagick.setsamplingfactors.html
    • /usr/share/doc/php-manual-en/imagick.setsize.html
    • /usr/share/doc/php-manual-en/imagick.setsizeoffset.html
    • /usr/share/doc/php-manual-en/imagick.settype.html
    • /usr/share/doc/php-manual-en/imagick.setup.html
    • /usr/share/doc/php-manual-en/imagick.shadeimage.html
    • /usr/share/doc/php-manual-en/imagick.shadowimage.html
    • /usr/share/doc/php-manual-en/imagick.sharpenimage.html
    • /usr/share/doc/php-manual-en/imagick.shaveimage.html
    • /usr/share/doc/php-manual-en/imagick.shearimage.html
    • /usr/share/doc/php-manual-en/imagick.sigmoidalcontrastimage.html
    • /usr/share/doc/php-manual-en/imagick.sketchimage.html
    • /usr/share/doc/php-manual-en/imagick.solarizeimage.html
    • /usr/share/doc/php-manual-en/imagick.sparsecolorimage.html
    • /usr/share/doc/php-manual-en/imagick.spliceimage.html
    • /usr/share/doc/php-manual-en/imagick.spreadimage.html
    • /usr/share/doc/php-manual-en/imagick.steganoimage.html
    • /usr/share/doc/php-manual-en/imagick.stereoimage.html
    • /usr/share/doc/php-manual-en/imagick.stripimage.html
    • /usr/share/doc/php-manual-en/imagick.swirlimage.html
    • /usr/share/doc/php-manual-en/imagick.textureimage.html
    • /usr/share/doc/php-manual-en/imagick.thresholdimage.html
    • /usr/share/doc/php-manual-en/imagick.thumbnailimage.html
    • /usr/share/doc/php-manual-en/imagick.tintimage.html
    • /usr/share/doc/php-manual-en/imagick.transformimage.html
    • /usr/share/doc/php-manual-en/imagick.transparentpaintimage.html
    • /usr/share/doc/php-manual-en/imagick.transposeimage.html
    • /usr/share/doc/php-manual-en/imagick.transverseimage.html
    • /usr/share/doc/php-manual-en/imagick.trimimage.html
    • /usr/share/doc/php-manual-en/imagick.uniqueimagecolors.html
    • /usr/share/doc/php-manual-en/imagick.unsharpmaskimage.html
    • /usr/share/doc/php-manual-en/imagick.valid.html
    • /usr/share/doc/php-manual-en/imagick.vignetteimage.html
    • /usr/share/doc/php-manual-en/imagick.waveimage.html
    • /usr/share/doc/php-manual-en/imagick.whitethresholdimage.html
    • /usr/share/doc/php-manual-en/imagick.writeimage.html
    • /usr/share/doc/php-manual-en/imagick.writeimagefile.html
    • /usr/share/doc/php-manual-en/imagick.writeimages.html
    • /usr/share/doc/php-manual-en/imagick.writeimagesfile.html
    • /usr/share/doc/php-manual-en/imagickdraw.affine.html
    • /usr/share/doc/php-manual-en/imagickdraw.annotation.html
    • /usr/share/doc/php-manual-en/imagickdraw.arc.html
    • /usr/share/doc/php-manual-en/imagickdraw.bezier.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/imagickdraw.clear.html
    • /usr/share/doc/php-manual-en/imagickdraw.clone.html
    • /usr/share/doc/php-manual-en/imagickdraw.color.html
    • /usr/share/doc/php-manual-en/imagickdraw.comment.html
    • /usr/share/doc/php-manual-en/imagickdraw.composite.html
    • /usr/share/doc/php-manual-en/imagickdraw.construct.html
    • /usr/share/doc/php-manual-en/imagickdraw.destroy.html
    • /usr/share/doc/php-manual-en/imagickdraw.ellipse.html
    • /usr/share/doc/php-manual-en/imagickdraw.getclippath.html
    • /usr/share/doc/php-manual-en/imagickdraw.getcliprule.html
    • /usr/share/doc/php-manual-en/imagickdraw.getclipunits.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfillcolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfillopacity.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfillrule.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfont.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfontfamily.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfontsize.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfontstyle.html
    • /usr/share/doc/php-manual-en/imagickdraw.getfontweight.html
    • /usr/share/doc/php-manual-en/imagickdraw.getgravity.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokeantialias.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokecolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokedasharray.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokedashoffset.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokelinecap.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokelinejoin.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokemiterlimit.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokeopacity.html
    • /usr/share/doc/php-manual-en/imagickdraw.getstrokewidth.html
    • /usr/share/doc/php-manual-en/imagickdraw.gettextalignment.html
    • /usr/share/doc/php-manual-en/imagickdraw.gettextantialias.html
    • /usr/share/doc/php-manual-en/imagickdraw.gettextdecoration.html
    • /usr/share/doc/php-manual-en/imagickdraw.gettextencoding.html
    • /usr/share/doc/php-manual-en/imagickdraw.gettextundercolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.getvectorgraphics.html
    • /usr/share/doc/php-manual-en/imagickdraw.line.html
    • /usr/share/doc/php-manual-en/imagickdraw.matte.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathclose.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetoabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetoquadraticbezierabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetoquadraticbezierrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetoquadraticbeziersmoothabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetoquadraticbeziersmoothrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetorelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetosmoothabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathcurvetosmoothrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathellipticarcabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathellipticarcrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathfinish.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetoabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetohorizontalabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetohorizontalrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetorelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetoverticalabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathlinetoverticalrelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathmovetoabsolute.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathmovetorelative.html
    • /usr/share/doc/php-manual-en/imagickdraw.pathstart.html
    • /usr/share/doc/php-manual-en/imagickdraw.point.html
    • /usr/share/doc/php-manual-en/imagickdraw.polygon.html
    • /usr/share/doc/php-manual-en/imagickdraw.polyline.html
    • /usr/share/doc/php-manual-en/imagickdraw.pop.html
    • /usr/share/doc/php-manual-en/imagickdraw.popclippath.html
    • /usr/share/doc/php-manual-en/imagickdraw.popdefs.html
    • /usr/share/doc/php-manual-en/imagickdraw.poppattern.html
    • /usr/share/doc/php-manual-en/imagickdraw.push.html
    • /usr/share/doc/php-manual-en/imagickdraw.pushclippath.html
    • /usr/share/doc/php-manual-en/imagickdraw.pushdefs.html
    • /usr/share/doc/php-manual-en/imagickdraw.pushpattern.html
    • /usr/share/doc/php-manual-en/imagickdraw.rectangle.html
    • /usr/share/doc/php-manual-en/imagickdraw.render.html
    • /usr/share/doc/php-manual-en/imagickdraw.rotate.html
    • /usr/share/doc/php-manual-en/imagickdraw.roundrectangle.html
    • /usr/share/doc/php-manual-en/imagickdraw.scale.html
    • /usr/share/doc/php-manual-en/imagickdraw.setclippath.html
    • /usr/share/doc/php-manual-en/imagickdraw.setcliprule.html
    • /usr/share/doc/php-manual-en/imagickdraw.setclipunits.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfillalpha.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfillcolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfillopacity.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfillpatternurl.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfillrule.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfont.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfontfamily.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfontsize.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfontstretch.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfontstyle.html
    • /usr/share/doc/php-manual-en/imagickdraw.setfontweight.html
    • /usr/share/doc/php-manual-en/imagickdraw.setgravity.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokealpha.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokeantialias.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokecolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokedasharray.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokedashoffset.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokelinecap.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokelinejoin.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokemiterlimit.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokeopacity.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokepatternurl.html
    • /usr/share/doc/php-manual-en/imagickdraw.setstrokewidth.html
    • /usr/share/doc/php-manual-en/imagickdraw.settextalignment.html
    • /usr/share/doc/php-manual-en/imagickdraw.settextantialias.html
    • /usr/share/doc/php-manual-en/imagickdraw.settextdecoration.html
    • /usr/share/doc/php-manual-en/imagickdraw.settextencoding.html
    • /usr/share/doc/php-manual-en/imagickdraw.settextundercolor.html
    • /usr/share/doc/php-manual-en/imagickdraw.setvectorgraphics.html
    • /usr/share/doc/php-manual-en/imagickdraw.setviewbox.html
    • /usr/share/doc/php-manual-en/imagickdraw.skewx.html
    • /usr/share/doc/php-manual-en/imagickdraw.skewy.html
    • /usr/share/doc/php-manual-en/imagickdraw.translate.html
    • /usr/share/doc/php-manual-en/imagickpixel.clear.html
    • /usr/share/doc/php-manual-en/imagickpixel.construct.html
    • /usr/share/doc/php-manual-en/imagickpixel.destroy.html
    • /usr/share/doc/php-manual-en/imagickpixel.getcolor.html
    • /usr/share/doc/php-manual-en/imagickpixel.getcolorasstring.html
    • /usr/share/doc/php-manual-en/imagickpixel.getcolorcount.html
    • /usr/share/doc/php-manual-en/imagickpixel.getcolorvalue.html
    • /usr/share/doc/php-manual-en/imagickpixel.gethsl.html
    • /usr/share/doc/php-manual-en/imagickpixel.ispixelsimilar.html
    • /usr/share/doc/php-manual-en/imagickpixel.issimilar.html
    • /usr/share/doc/php-manual-en/imagickpixel.setcolor.html
    • /usr/share/doc/php-manual-en/imagickpixel.setcolorvalue.html
    • /usr/share/doc/php-manual-en/imagickpixel.sethsl.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.clear.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.construct.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.destroy.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.getcurrentiteratorrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.getiteratorrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.getnextiteratorrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.getpreviousiteratorrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.newpixeliterator.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.newpixelregioniterator.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.resetiterator.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.setiteratorfirstrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.setiteratorlastrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.setiteratorrow.html
    • /usr/share/doc/php-manual-en/imagickpixeliterator.synciterator.html
    • /usr/share/doc/php-manual-en/imap.configuration.html
    • /usr/share/doc/php-manual-en/imap.constants.html
    • /usr/share/doc/php-manual-en/imap.installation.html
    • /usr/share/doc/php-manual-en/imap.requirements.html
    • /usr/share/doc/php-manual-en/imap.resources.html
    • /usr/share/doc/php-manual-en/imap.setup.html
    • /usr/share/doc/php-manual-en/inclued.configuration.html
    • /usr/share/doc/php-manual-en/inclued.constants.html
    • /usr/share/doc/php-manual-en/inclued.examples-implementation.html
    • /usr/share/doc/php-manual-en/inclued.examples.html
    • /usr/share/doc/php-manual-en/inclued.installation.html
    • /usr/share/doc/php-manual-en/inclued.requirements.html
    • /usr/share/doc/php-manual-en/inclued.resources.html
    • /usr/share/doc/php-manual-en/inclued.setup.html
    • /usr/share/doc/php-manual-en/index.html
    • /usr/share/doc/php-manual-en/indexes.examples.html
    • /usr/share/doc/php-manual-en/indexes.functions.html
    • /usr/share/doc/php-manual-en/indexes.html
    • /usr/share/doc/php-manual-en/infiniteiterator.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/info.configuration.html
    • /usr/share/doc/php-manual-en/info.constants.html
    • /usr/share/doc/php-manual-en/info.installation.html
    • /usr/share/doc/php-manual-en/info.requirements.html
    • /usr/share/doc/php-manual-en/info.resources.html
    • /usr/share/doc/php-manual-en/info.setup.html
    • /usr/share/doc/php-manual-en/ingres.configuration.html
    • /usr/share/doc/php-manual-en/ingres.constants.html
    • /usr/share/doc/php-manual-en/ingres.examples-basic.html
    • /usr/share/doc/php-manual-en/ingres.examples.html
    • /usr/share/doc/php-manual-en/ingres.installation.html
    • /usr/share/doc/php-manual-en/ingres.requirements.html
    • /usr/share/doc/php-manual-en/ingres.resources.html
    • /usr/share/doc/php-manual-en/ingres.setup.html
    • /usr/share/doc/php-manual-en/ini.core.html
    • /usr/share/doc/php-manual-en/ini.html
    • /usr/share/doc/php-manual-en/ini.list.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ini.sections.html
    • /usr/share/doc/php-manual-en/inotify.configuration.html
    • /usr/share/doc/php-manual-en/inotify.constants.html
    • /usr/share/doc/php-manual-en/inotify.install.html
    • /usr/share/doc/php-manual-en/inotify.requirements.html
    • /usr/share/doc/php-manual-en/inotify.resources.html
    • /usr/share/doc/php-manual-en/inotify.setup.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/install.fpm.configuration.html
    • /usr/share/doc/php-manual-en/install.fpm.html
    • /usr/share/doc/php-manual-en/install.fpm.install.html
    • /usr/share/doc/php-manual-en/install.general.html
    • /usr/share/doc/php-manual-en/install.html
    • /usr/share/doc/php-manual-en/install.macosx.bundled.html
    • /usr/share/doc/php-manual-en/install.macosx.compile.html
    • /usr/share/doc/php-manual-en/install.macosx.html
    • /usr/share/doc/php-manual-en/install.macosx.packages.html
    • /usr/share/doc/php-manual-en/install.pecl.downloads.html
    • /usr/share/doc/php-manual-en/install.pecl.html
    • /usr/share/doc/php-manual-en/install.pecl.intro.html
    • /usr/share/doc/php-manual-en/install.pecl.pear.html
    • /usr/share/doc/php-manual-en/install.pecl.php-config.html
    • /usr/share/doc/php-manual-en/install.pecl.phpize.html
    • /usr/share/doc/php-manual-en/install.pecl.static.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/install.problems.bugs.html
    • /usr/share/doc/php-manual-en/install.problems.faq.html
    • /usr/share/doc/php-manual-en/install.problems.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/install.unix.apache.html
    • /usr/share/doc/php-manual-en/install.unix.apache2.html
    • /usr/share/doc/php-manual-en/install.unix.commandline.html
    • /usr/share/doc/php-manual-en/install.unix.debian.html
    • /usr/share/doc/php-manual-en/install.unix.hpux.html
    • /usr/share/doc/php-manual-en/install.unix.html
    • /usr/share/doc/php-manual-en/install.unix.lighttpd-14.html
    • /usr/share/doc/php-manual-en/install.unix.openbsd.html
    • /usr/share/doc/php-manual-en/install.unix.solaris.html
    • /usr/share/doc/php-manual-en/install.unix.sun.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.apiref.html
    • /usr/share/doc/php-manual-en/internals2.buildsys.configunix.html
    • /usr/share/doc/php-manual-en/internals2.buildsys.configwin.html
    • /usr/share/doc/php-manual-en/internals2.buildsys.environment.html
    • /usr/share/doc/php-manual-en/internals2.buildsys.html
    • /usr/share/doc/php-manual-en/internals2.buildsys.skeleton.html
    • /usr/share/doc/php-manual-en/internals2.classes.html
    • /usr/share/doc/php-manual-en/internals2.counter.basic-interface.html
    • /usr/share/doc/php-manual-en/internals2.counter.constants.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.bumpvalue.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.construct.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.getmeta.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.getnamed.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.getvalue.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.resetvalue.html
    • /usr/share/doc/php-manual-en/internals2.counter.counter-class.setcounterclass.html
    • /usr/share/doc/php-manual-en/internals2.counter.examples.basic.html
    • /usr/share/doc/php-manual-en/internals2.counter.examples.extended.html
    • /usr/share/doc/php-manual-en/internals2.counter.examples.html
    • /usr/share/doc/php-manual-en/internals2.counter.examples.objective.html
    • /usr/share/doc/php-manual-en/internals2.counter.extended-interface.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-bump-value.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-bump.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-create.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-get-meta.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-get-named.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-get-value.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-get.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-reset-value.html
    • /usr/share/doc/php-manual-en/internals2.counter.function.counter-reset.html
    • /usr/share/doc/php-manual-en/internals2.counter.html
    • /usr/share/doc/php-manual-en/internals2.counter.ini.html
    • /usr/share/doc/php-manual-en/internals2.counter.intro.html
    • /usr/share/doc/php-manual-en/internals2.counter.resources.html
    • /usr/share/doc/php-manual-en/internals2.counter.setup.html
    • /usr/share/doc/php-manual-en/internals2.faq.html
    • /usr/share/doc/php-manual-en/internals2.funcs.html
    • /usr/share/doc/php-manual-en/internals2.html
    • /usr/share/doc/php-manual-en/internals2.ini.html
    • /usr/share/doc/php-manual-en/internals2.memory.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.memory.persistence.html
    • /usr/share/doc/php-manual-en/internals2.memory.tsrm.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add-array-element.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add-char.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add-interface.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add-string.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add-var.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.add.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-add.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-bw-and.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-bw-or.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-bw-xor.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-concat.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-dim.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-div.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-mod.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-mul.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-ref.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-sl.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-sr.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign-sub.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.assign.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.begin-silence.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.bool-not.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.bool-xor.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.bool.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.brk.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.cast.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.catch.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.clone.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.concat.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.cont.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.declare-class.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.declare-const.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.declare-function.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.declare-inherited-class-delayed.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.declare-inherited-class.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.div.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.echo.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.end-silence.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.exit.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.ext-fcall-begin.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.ext-fcall-end.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.ext-nop.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.ext-stmt.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fe-fetch.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fe-reset.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-class.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-constant.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-func-arg.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-is.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-r.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-rw.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-tmp-var.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-unset.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-dim-w.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-func-arg.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-is.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-func-arg.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-is.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-r.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-rw.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-unset.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-obj-w.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-r.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-rw.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-unset.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.fetch-w.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.goto.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.handle-exception.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.include-or-eval.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-array.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-fcall-by-name.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-method-call.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-ns-fcall-by-name.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-static-method-call.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.init-string.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.instanceof.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.isset-isempty-dim-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.isset-isempty-prop-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.isset-isempty-var.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.jmpnz-ex.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.jmpnz.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.jmpz-ex.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.jmpz.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.jmpznz.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.list.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.mod.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.mul.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.nop.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.pre-dec-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.pre-dec.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.pre-inc-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.pre-inc.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.print.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.qm-assign.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.raise-abstract-error.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.recv-init.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.recv.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.return-by-ref.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.return.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.send-ref.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.send-val.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.send-var-no-ref.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.send-var.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/internals2.opcodes.sub.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.switch-free.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.throw.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.ticks.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.unset-dim.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.unset-obj.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.unset-var.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.user-opcode.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.verify-abstract-class.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.zend-declare-lambda-function.html
    • /usr/share/doc/php-manual-en/internals2.opcodes.zend-jmp-set.html
    • /usr/share/doc/php-manual-en/internals2.pdo.building.html
    • /usr/share/doc/php-manual-en/internals2.pdo.constants.html
    • /usr/share/doc/php-manual-en/internals2.pdo.error-handling.html
    • /usr/share/doc/php-manual-en/internals2.pdo.html
    • /usr/share/doc/php-manual-en/internals2.pdo.implementing.html
    • /usr/share/doc/php-manual-en/internals2.pdo.packaging.html
    • /usr/share/doc/php-manual-en/internals2.pdo.pdo-dbh-t.html
    • /usr/share/doc/php-manual-en/internals2.pdo.pdo-stmt-t.html
    • /usr/share/doc/php-manual-en/internals2.pdo.preparation.html
    • /usr/share/doc/php-manual-en/internals2.pdo.prerequisites.html
    • /usr/share/doc/php-manual-en/internals2.pdo.testing.html
    • /usr/share/doc/php-manual-en/internals2.preface.html
    • /usr/share/doc/php-manual-en/internals2.resources.html
    • /usr/share/doc/php-manual-en/internals2.streams.html
    • /usr/share/doc/php-manual-en/internals2.structure.basics.html
    • /usr/share/doc/php-manual-en/internals2.structure.files.html
    • /usr/share/doc/php-manual-en/internals2.structure.globals.html
    • /usr/share/doc/php-manual-en/internals2.structure.html
    • /usr/share/doc/php-manual-en/internals2.structure.lifecycle.html
    • /usr/share/doc/php-manual-en/internals2.structure.modstruct.html
    • /usr/share/doc/php-manual-en/internals2.structure.tests.html
    • /usr/share/doc/php-manual-en/internals2.variables.arrays.html
    • /usr/share/doc/php-manual-en/internals2.variables.html
    • /usr/share/doc/php-manual-en/internals2.variables.intro.html
    • /usr/share/doc/php-manual-en/internals2.variables.objects.html
    • /usr/share/doc/php-manual-en/internals2.variables.tables.html
    • /usr/share/doc/php-manual-en/internals2.ze1.html
    • /usr/share/doc/php-manual-en/internals2.ze1.intro.html
    • /usr/share/doc/php-manual-en/internals2.ze1.streams.html
    • /usr/share/doc/php-manual-en/internals2.ze1.tsrm.html
    • /usr/share/doc/php-manual-en/internals2.ze1.zendapi.html
    • /usr/share/doc/php-manual-en/intl.configuration.html
    • /usr/share/doc/php-manual-en/intl.constants.html
    • /usr/share/doc/php-manual-en/intl.examples.basic.html
    • /usr/share/doc/php-manual-en/intl.examples.html
    • /usr/share/doc/php-manual-en/intl.installation.html
    • /usr/share/doc/php-manual-en/intl.requirements.html
    • /usr/share/doc/php-manual-en/intl.resources.html
    • /usr/share/doc/php-manual-en/intl.setup.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.construct.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createcharacterinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createcodepointinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createlineinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createsentenceinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createtitleinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.createwordinstance.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.current.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.first.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.following.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.geterrorcode.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.geterrormessage.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.getlocale.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.getpartsiterator.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.gettext.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.isboundary.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.last.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intlbreakiterator.preceding.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.previous.html
    • /usr/share/doc/php-manual-en/intlbreakiterator.settext.html
    • /usr/share/doc/php-manual-en/intlcalendar.add.html
    • /usr/share/doc/php-manual-en/intlcalendar.after.html
    • /usr/share/doc/php-manual-en/intlcalendar.before.html
    • /usr/share/doc/php-manual-en/intlcalendar.clear.html
    • /usr/share/doc/php-manual-en/intlcalendar.construct.html
    • /usr/share/doc/php-manual-en/intlcalendar.createinstance.html
    • /usr/share/doc/php-manual-en/intlcalendar.equals.html
    • /usr/share/doc/php-manual-en/intlcalendar.fielddifference.html
    • /usr/share/doc/php-manual-en/intlcalendar.fromdatetime.html
    • /usr/share/doc/php-manual-en/intlcalendar.get.html
    • /usr/share/doc/php-manual-en/intlcalendar.getactualmaximum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getactualminimum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getavailablelocales.html
    • /usr/share/doc/php-manual-en/intlcalendar.getdayofweektype.html
    • /usr/share/doc/php-manual-en/intlcalendar.geterrorcode.html
    • /usr/share/doc/php-manual-en/intlcalendar.geterrormessage.html
    • /usr/share/doc/php-manual-en/intlcalendar.getfirstdayofweek.html
    • /usr/share/doc/php-manual-en/intlcalendar.getgreatestminimum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getkeywordvaluesforlocale.html
    • /usr/share/doc/php-manual-en/intlcalendar.getleastmaximum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getlocale.html
    • /usr/share/doc/php-manual-en/intlcalendar.getmaximum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getminimaldaysinfirstweek.html
    • /usr/share/doc/php-manual-en/intlcalendar.getminimum.html
    • /usr/share/doc/php-manual-en/intlcalendar.getnow.html
    • /usr/share/doc/php-manual-en/intlcalendar.getrepeatedwalltimeoption.html
    • /usr/share/doc/php-manual-en/intlcalendar.getskippedwalltimeoption.html
    • /usr/share/doc/php-manual-en/intlcalendar.gettime.html
    • /usr/share/doc/php-manual-en/intlcalendar.gettimezone.html
    • /usr/share/doc/php-manual-en/intlcalendar.gettype.html
    • /usr/share/doc/php-manual-en/intlcalendar.getweekendtransition.html
    • /usr/share/doc/php-manual-en/intlcalendar.indaylighttime.html
    • /usr/share/doc/php-manual-en/intlcalendar.isequivalentto.html
    • /usr/share/doc/php-manual-en/intlcalendar.islenient.html
    • /usr/share/doc/php-manual-en/intlcalendar.isset.html
    • /usr/share/doc/php-manual-en/intlcalendar.isweekend.html
    • /usr/share/doc/php-manual-en/intlcalendar.roll.html
    • /usr/share/doc/php-manual-en/intlcalendar.set.html
    • /usr/share/doc/php-manual-en/intlcalendar.setfirstdayofweek.html
    • /usr/share/doc/php-manual-en/intlcalendar.setlenient.html
    • /usr/share/doc/php-manual-en/intlcalendar.setrepeatedwalltimeoption.html
    • /usr/share/doc/php-manual-en/intlcalendar.setskippedwalltimeoption.html
    • /usr/share/doc/php-manual-en/intlcalendar.settime.html
    • /usr/share/doc/php-manual-en/intlcalendar.settimezone.html
    • /usr/share/doc/php-manual-en/intlcalendar.todatetime.html
    • /usr/share/doc/php-manual-en/intlcodepointbreakiterator.getlastcodepoint.html
    • /usr/share/doc/php-manual-en/intldateformatter.create.html
    • /usr/share/doc/php-manual-en/intldateformatter.format.html
    • /usr/share/doc/php-manual-en/intldateformatter.formatobject.html
    • /usr/share/doc/php-manual-en/intldateformatter.getcalendar.html
    • /usr/share/doc/php-manual-en/intldateformatter.getcalendarobject.html
    • /usr/share/doc/php-manual-en/intldateformatter.getdatetype.html
    • /usr/share/doc/php-manual-en/intldateformatter.geterrorcode.html
    • /usr/share/doc/php-manual-en/intldateformatter.geterrormessage.html
    • /usr/share/doc/php-manual-en/intldateformatter.getlocale.html
    • /usr/share/doc/php-manual-en/intldateformatter.getpattern.html
    • /usr/share/doc/php-manual-en/intldateformatter.gettimetype.html
    • /usr/share/doc/php-manual-en/intldateformatter.gettimezone.html
    • /usr/share/doc/php-manual-en/intldateformatter.gettimezoneid.html
    • /usr/share/doc/php-manual-en/intldateformatter.islenient.html
    • /usr/share/doc/php-manual-en/intldateformatter.localtime.html
    • /usr/share/doc/php-manual-en/intldateformatter.parse.html
    • /usr/share/doc/php-manual-en/intldateformatter.setcalendar.html
    • /usr/share/doc/php-manual-en/intldateformatter.setlenient.html
    • /usr/share/doc/php-manual-en/intldateformatter.setpattern.html
    • /usr/share/doc/php-manual-en/intldateformatter.settimezone.html
    • /usr/share/doc/php-manual-en/intldateformatter.settimezoneid.html
    • /usr/share/doc/php-manual-en/intliterator.current.html
    • /usr/share/doc/php-manual-en/intliterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intliterator.rewind.html
    • /usr/share/doc/php-manual-en/intliterator.valid.html
    • /usr/share/doc/php-manual-en/intlpartsiterator.getbreakiterator.html
    • /usr/share/doc/php-manual-en/intlrulebasedbreakiterator.construct.html
    • /usr/share/doc/php-manual-en/intlrulebasedbreakiterator.getbinaryrules.html
    • /usr/share/doc/php-manual-en/intlrulebasedbreakiterator.getrules.html
    • /usr/share/doc/php-manual-en/intlrulebasedbreakiterator.getrulestatus.html
    • /usr/share/doc/php-manual-en/intlrulebasedbreakiterator.getrulestatusvec.html
    • /usr/share/doc/php-manual-en/intltimezone.countequivalentids.html
    • /usr/share/doc/php-manual-en/intltimezone.createdefault.html
    • /usr/share/doc/php-manual-en/intltimezone.createenumeration.html
    • /usr/share/doc/php-manual-en/intltimezone.createtimezone.html
    • /usr/share/doc/php-manual-en/intltimezone.fromdatetimezone.html
    • /usr/share/doc/php-manual-en/intltimezone.getcanonicalid.html
    • /usr/share/doc/php-manual-en/intltimezone.getdisplayname.html
    • /usr/share/doc/php-manual-en/intltimezone.getdstsavings.html
    • /usr/share/doc/php-manual-en/intltimezone.getequivalentid.html
    • /usr/share/doc/php-manual-en/intltimezone.geterrorcode.html
    • /usr/share/doc/php-manual-en/intltimezone.geterrormessage.html
    • /usr/share/doc/php-manual-en/intltimezone.getgmt.html
    • /usr/share/doc/php-manual-en/intltimezone.getid.html
    • /usr/share/doc/php-manual-en/intltimezone.getoffset.html
    • /usr/share/doc/php-manual-en/intltimezone.getrawoffset.html
    • /usr/share/doc/php-manual-en/intltimezone.gettzdataversion.html
    • /usr/share/doc/php-manual-en/intltimezone.hassamerules.html
    • /usr/share/doc/php-manual-en/intltimezone.todatetimezone.html
    • /usr/share/doc/php-manual-en/intltimezone.usedaylighttime.html
    • /usr/share/doc/php-manual-en/intro-whatcando.html
    • /usr/share/doc/php-manual-en/intro-whatis.html
    • /usr/share/doc/php-manual-en/intro.amqp.html
    • /usr/share/doc/php-manual-en/intro.apache.html
    • /usr/share/doc/php-manual-en/intro.apc.html
    • /usr/share/doc/php-manual-en/intro.apd.html
    • /usr/share/doc/php-manual-en/intro.array.html
    • /usr/share/doc/php-manual-en/intro.bbcode.html
    • /usr/share/doc/php-manual-en/intro.bc.html
    • /usr/share/doc/php-manual-en/intro.bcompiler.html
    • /usr/share/doc/php-manual-en/intro.blenc.html
    • /usr/share/doc/php-manual-en/intro.bzip2.html
    • /usr/share/doc/php-manual-en/intro.cairo.html
    • /usr/share/doc/php-manual-en/intro.calendar.html
    • /usr/share/doc/php-manual-en/intro.chdb.html
    • /usr/share/doc/php-manual-en/intro.classkit.html
    • /usr/share/doc/php-manual-en/intro.classobj.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.crack.html
    • /usr/share/doc/php-manual-en/intro.ctype.html
    • /usr/share/doc/php-manual-en/intro.cubrid.html
    • /usr/share/doc/php-manual-en/intro.curl.html
    • /usr/share/doc/php-manual-en/intro.cyrus.html
    • /usr/share/doc/php-manual-en/intro.datetime.html
    • /usr/share/doc/php-manual-en/intro.dba.html
    • /usr/share/doc/php-manual-en/intro.dbase.html
    • /usr/share/doc/php-manual-en/intro.dbplus.html
    • /usr/share/doc/php-manual-en/intro.dbx.html
    • /usr/share/doc/php-manual-en/intro.dio.html
    • /usr/share/doc/php-manual-en/intro.dom.html
    • /usr/share/doc/php-manual-en/intro.eio.html
    • /usr/share/doc/php-manual-en/intro.enchant.html
    • /usr/share/doc/php-manual-en/intro.errorfunc.html
    • /usr/share/doc/php-manual-en/intro.ev.html
    • /usr/share/doc/php-manual-en/intro.event.html
    • /usr/share/doc/php-manual-en/intro.exec.html
    • /usr/share/doc/php-manual-en/intro.exif.html
    • /usr/share/doc/php-manual-en/intro.expect.html
    • /usr/share/doc/php-manual-en/intro.fam.html
    • /usr/share/doc/php-manual-en/intro.fann.html
    • /usr/share/doc/php-manual-en/intro.fbsql.html
    • /usr/share/doc/php-manual-en/intro.fdf.html
    • /usr/share/doc/php-manual-en/intro.fileinfo.html
    • /usr/share/doc/php-manual-en/intro.filepro.html
    • /usr/share/doc/php-manual-en/intro.filesystem.html
    • /usr/share/doc/php-manual-en/intro.filter.html
    • /usr/share/doc/php-manual-en/intro.fpm.html
    • /usr/share/doc/php-manual-en/intro.fribidi.html
    • /usr/share/doc/php-manual-en/intro.ftp.html
    • /usr/share/doc/php-manual-en/intro.funchand.html
    • /usr/share/doc/php-manual-en/intro.gearman.html
    • /usr/share/doc/php-manual-en/intro.gender.html
    • /usr/share/doc/php-manual-en/intro.geoip.html
    • /usr/share/doc/php-manual-en/intro.gettext.html
    • /usr/share/doc/php-manual-en/intro.gmagick.html
    • /usr/share/doc/php-manual-en/intro.gmp.html
    • /usr/share/doc/php-manual-en/intro.gnupg.html
    • /usr/share/doc/php-manual-en/intro.gupnp.html
    • /usr/share/doc/php-manual-en/intro.haru.html
    • /usr/share/doc/php-manual-en/intro.hash.html
    • /usr/share/doc/php-manual-en/intro.htscanner.html
    • /usr/share/doc/php-manual-en/intro.http.html
    • /usr/share/doc/php-manual-en/intro.hw.html
    • /usr/share/doc/php-manual-en/intro.hwapi.html
    • /usr/share/doc/php-manual-en/intro.ibase.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.iconv.html
    • /usr/share/doc/php-manual-en/intro.id3.html
    • /usr/share/doc/php-manual-en/intro.ifx.html
    • /usr/share/doc/php-manual-en/intro.iisfunc.html
    • /usr/share/doc/php-manual-en/intro.image.html
    • /usr/share/doc/php-manual-en/intro.imagick.html
    • /usr/share/doc/php-manual-en/intro.imap.html
    • /usr/share/doc/php-manual-en/intro.inclued.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.ingres.html
    • /usr/share/doc/php-manual-en/intro.inotify.html
    • /usr/share/doc/php-manual-en/intro.intl.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.json.html
    • /usr/share/doc/php-manual-en/intro.judy.html
    • /usr/share/doc/php-manual-en/intro.kadm5.html
    • /usr/share/doc/php-manual-en/intro.ktaglib.html
    • /usr/share/doc/php-manual-en/intro.lapack.html
    • /usr/share/doc/php-manual-en/intro.ldap.html
    • /usr/share/doc/php-manual-en/intro.libevent.html
    • /usr/share/doc/php-manual-en/intro.libxml.html
    • /usr/share/doc/php-manual-en/intro.lua.html
    • /usr/share/doc/php-manual-en/intro.lzf.html
    • /usr/share/doc/php-manual-en/intro.mail.html
    • /usr/share/doc/php-manual-en/intro.mailparse.html
    • /usr/share/doc/php-manual-en/intro.math.html
    • /usr/share/doc/php-manual-en/intro.maxdb.html
    • /usr/share/doc/php-manual-en/intro.mbstring.html
    • /usr/share/doc/php-manual-en/intro.mcrypt.html
    • /usr/share/doc/php-manual-en/intro.mcve.html
    • /usr/share/doc/php-manual-en/intro.memcache.html
    • /usr/share/doc/php-manual-en/intro.memcached.html
    • /usr/share/doc/php-manual-en/intro.memtrack.html
    • /usr/share/doc/php-manual-en/intro.mhash.html
    • /usr/share/doc/php-manual-en/intro.mime-magic.html
    • /usr/share/doc/php-manual-en/intro.ming.html
    • /usr/share/doc/php-manual-en/intro.misc.html
    • /usr/share/doc/php-manual-en/intro.mnogosearch.html
    • /usr/share/doc/php-manual-en/intro.mqseries.html
    • /usr/share/doc/php-manual-en/intro.msession.html
    • /usr/share/doc/php-manual-en/intro.msql.html
    • /usr/share/doc/php-manual-en/intro.mssql.html
    • /usr/share/doc/php-manual-en/intro.mysql.html
    • /usr/share/doc/php-manual-en/intro.mysqli.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd-memcache.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd-ms.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd-mux.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd-qc.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd-uh.html
    • /usr/share/doc/php-manual-en/intro.mysqlnd.html
    • /usr/share/doc/php-manual-en/intro.ncurses.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.newt.html
    • /usr/share/doc/php-manual-en/intro.nis.html
    • /usr/share/doc/php-manual-en/intro.notes.html
    • /usr/share/doc/php-manual-en/intro.nsapi.html
    • /usr/share/doc/php-manual-en/intro.oauth.html
    • /usr/share/doc/php-manual-en/intro.objaggregation.html
    • /usr/share/doc/php-manual-en/intro.oci8.html
    • /usr/share/doc/php-manual-en/intro.oggvorbis.html
    • /usr/share/doc/php-manual-en/intro.opcache.html
    • /usr/share/doc/php-manual-en/intro.openal.html
    • /usr/share/doc/php-manual-en/intro.openssl.html
    • /usr/share/doc/php-manual-en/intro.outcontrol.html
    • /usr/share/doc/php-manual-en/intro.ovrimos.html
    • /usr/share/doc/php-manual-en/intro.paradox.html
    • /usr/share/doc/php-manual-en/intro.parsekit.html
    • /usr/share/doc/php-manual-en/intro.password.html
    • /usr/share/doc/php-manual-en/intro.pcntl.html
    • /usr/share/doc/php-manual-en/intro.pcre.html
    • /usr/share/doc/php-manual-en/intro.pdf.html
    • /usr/share/doc/php-manual-en/intro.pdo.html
    • /usr/share/doc/php-manual-en/intro.pgsql.html
    • /usr/share/doc/php-manual-en/intro.phar.html
    • /usr/share/doc/php-manual-en/intro.posix.html
    • /usr/share/doc/php-manual-en/intro.printer.html
    • /usr/share/doc/php-manual-en/intro.proctitle.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.pspell.html
    • /usr/share/doc/php-manual-en/intro.pthreads.html
    • /usr/share/doc/php-manual-en/intro.qtdom.html
    • /usr/share/doc/php-manual-en/intro.quickhash.html
    • /usr/share/doc/php-manual-en/intro.radius.html
    • /usr/share/doc/php-manual-en/intro.rar.html
    • /usr/share/doc/php-manual-en/intro.readline.html
    • /usr/share/doc/php-manual-en/intro.recode.html
    • /usr/share/doc/php-manual-en/intro.reflection.html
    • /usr/share/doc/php-manual-en/intro.regex.html
    • /usr/share/doc/php-manual-en/intro.rpmreader.html
    • /usr/share/doc/php-manual-en/intro.rrd.html
    • /usr/share/doc/php-manual-en/intro.runkit.html
    • /usr/share/doc/php-manual-en/intro.sam.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.scream.html
    • /usr/share/doc/php-manual-en/intro.sdo-das-xml.html
    • /usr/share/doc/php-manual-en/intro.sdo.html
    • /usr/share/doc/php-manual-en/intro.sdodasrel.html
    • /usr/share/doc/php-manual-en/intro.sem.html
    • /usr/share/doc/php-manual-en/intro.session-pgsql.html
    • /usr/share/doc/php-manual-en/intro.session.html
    • /usr/share/doc/php-manual-en/intro.shmop.html
    • /usr/share/doc/php-manual-en/intro.simplexml.html
    • /usr/share/doc/php-manual-en/intro.snmp.html
    • /usr/share/doc/php-manual-en/intro.soap.html
    • /usr/share/doc/php-manual-en/intro.sockets.html
    • /usr/share/doc/php-manual-en/intro.solr.html
    • /usr/share/doc/php-manual-en/intro.sphinx.html
    • /usr/share/doc/php-manual-en/intro.spl-types.html
    • /usr/share/doc/php-manual-en/intro.spl.html
    • /usr/share/doc/php-manual-en/intro.spplus.html
    • /usr/share/doc/php-manual-en/intro.sqlite.html
    • /usr/share/doc/php-manual-en/intro.sqlite3.html
    • /usr/share/doc/php-manual-en/intro.sqlsrv.html
    • /usr/share/doc/php-manual-en/intro.ssdeep.html
    • /usr/share/doc/php-manual-en/intro.ssh2.html
    • /usr/share/doc/php-manual-en/intro.stats.html
    • /usr/share/doc/php-manual-en/intro.stomp.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.strings.html
    • /usr/share/doc/php-manual-en/intro.svm.html
    • /usr/share/doc/php-manual-en/intro.svn.html
    • /usr/share/doc/php-manual-en/intro.swf.html
    • /usr/share/doc/php-manual-en/intro.swish.html
    • /usr/share/doc/php-manual-en/intro.sybase.html
    • /usr/share/doc/php-manual-en/intro.taint.html
    • /usr/share/doc/php-manual-en/intro.tcpwrap.html
    • /usr/share/doc/php-manual-en/intro.tidy.html
    • /usr/share/doc/php-manual-en/intro.tokenizer.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.trader.html
    • /usr/share/doc/php-manual-en/intro.uodbc.html
    • /usr/share/doc/php-manual-en/intro.url.html
    • /usr/share/doc/php-manual-en/intro.v8js.html
    • /usr/share/doc/php-manual-en/intro.var.html
    • /usr/share/doc/php-manual-en/intro.varnish.html
    • /usr/share/doc/php-manual-en/intro.vpopmail.html
    • /usr/share/doc/php-manual-en/intro.w32api.html
    • /usr/share/doc/php-manual-en/intro.wddx.html
    • /usr/share/doc/php-manual-en/intro.weakref.html
    • /usr/share/doc/php-manual-en/intro.win32ps.html
    • /usr/share/doc/php-manual-en/intro.win32service.html
    • /usr/share/doc/php-manual-en/intro.wincache.html
    • /usr/share/doc/php-manual-en/intro.xattr.html
    • /usr/share/doc/php-manual-en/intro.xdiff.html
    • /usr/share/doc/php-manual-en/intro.xhprof.html
    • /usr/share/doc/php-manual-en/intro.xml.html
    • /usr/share/doc/php-manual-en/intro.xmldiff.html
    • /usr/share/doc/php-manual-en/intro.xmlreader.html
    • /usr/share/doc/php-manual-en/intro.xmlrpc.html
    • /usr/share/doc/php-manual-en/intro.xmlwriter.html
    • /usr/share/doc/php-manual-en/intro.xsl.html
    • /usr/share/doc/php-manual-en/intro.xslt.html
    • /usr/share/doc/php-manual-en/intro.yaf.html
    • /usr/share/doc/php-manual-en/intro.yaml.html
    • /usr/share/doc/php-manual-en/intro.yar.html
    • /usr/share/doc/php-manual-en/intro.yaz.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/intro.zlib.html
    • /usr/share/doc/php-manual-en/intro.zmq.html
    • /usr/share/doc/php-manual-en/introduction.html
    • /usr/share/doc/php-manual-en/iterator.current.html
    • /usr/share/doc/php-manual-en/iterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/iterator.rewind.html
    • /usr/share/doc/php-manual-en/iterator.valid.html
    • /usr/share/doc/php-manual-en/iteratoraggregate.getiterator.html
    • /usr/share/doc/php-manual-en/iteratoriterator.construct.html
    • /usr/share/doc/php-manual-en/iteratoriterator.current.html
    • /usr/share/doc/php-manual-en/iteratoriterator.getinneriterator.html
    • /usr/share/doc/php-manual-en/iteratoriterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/iteratoriterator.rewind.html
    • /usr/share/doc/php-manual-en/iteratoriterator.valid.html
    • /usr/share/doc/php-manual-en/java.configuration.html
    • /usr/share/doc/php-manual-en/java.constants.html
    • /usr/share/doc/php-manual-en/java.examples-basic.html
    • /usr/share/doc/php-manual-en/java.examples.html
    • /usr/share/doc/php-manual-en/java.installation.html
    • /usr/share/doc/php-manual-en/java.requirements.html
    • /usr/share/doc/php-manual-en/java.resources.html
    • /usr/share/doc/php-manual-en/java.servlet.html
    • /usr/share/doc/php-manual-en/java.setup.html
    • /usr/share/doc/php-manual-en/json.configuration.html
    • /usr/share/doc/php-manual-en/json.constants.html
    • /usr/share/doc/php-manual-en/json.installation.html
    • /usr/share/doc/php-manual-en/json.requirements.html
    • /usr/share/doc/php-manual-en/json.resources.html
    • /usr/share/doc/php-manual-en/json.setup.html
    • /usr/share/doc/php-manual-en/jsonserializable.jsonserialize.html
    • /usr/share/doc/php-manual-en/judy.bycount.html
    • /usr/share/doc/php-manual-en/judy.configuration.html
    • /usr/share/doc/php-manual-en/judy.construct.html
    • /usr/share/doc/php-manual-en/judy.count.html
    • /usr/share/doc/php-manual-en/judy.destruct.html
    • /usr/share/doc/php-manual-en/judy.first.html
    • /usr/share/doc/php-manual-en/judy.firstempty.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/judy.gettype.html
    • /usr/share/doc/php-manual-en/judy.installation.html
    • /usr/share/doc/php-manual-en/judy.last.html
    • /usr/share/doc/php-manual-en/judy.lastempty.html
    • /usr/share/doc/php-manual-en/judy.memoryusage.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/judy.nextempty.html
    • /usr/share/doc/php-manual-en/judy.offsetexists.html
    • /usr/share/doc/php-manual-en/judy.offsetget.html
    • /usr/share/doc/php-manual-en/judy.offsetset.html
    • /usr/share/doc/php-manual-en/judy.offsetunset.html
    • /usr/share/doc/php-manual-en/judy.prev.html
    • /usr/share/doc/php-manual-en/judy.prevempty.html
    • /usr/share/doc/php-manual-en/judy.requirements.html
    • /usr/share/doc/php-manual-en/judy.resources.html
    • /usr/share/doc/php-manual-en/judy.setup.html
    • /usr/share/doc/php-manual-en/judy.size.html
    • /usr/share/doc/php-manual-en/kadm5.configuration.html
    • /usr/share/doc/php-manual-en/kadm5.constants.html
    • /usr/share/doc/php-manual-en/kadm5.constantsaf.html
    • /usr/share/doc/php-manual-en/kadm5.examples-connect.html
    • /usr/share/doc/php-manual-en/kadm5.examples.html
    • /usr/share/doc/php-manual-en/kadm5.installation.html
    • /usr/share/doc/php-manual-en/kadm5.requirements.html
    • /usr/share/doc/php-manual-en/kadm5.resources.html
    • /usr/share/doc/php-manual-en/kadm5.setup.html
    • /usr/share/doc/php-manual-en/keyword.class.html
    • /usr/share/doc/php-manual-en/keyword.extends.html
    • /usr/share/doc/php-manual-en/keyword.paamayim-nekudotayim.html
    • /usr/share/doc/php-manual-en/keyword.parent.html
    • /usr/share/doc/php-manual-en/ktaglib.constants.html
    • /usr/share/doc/php-manual-en/ktaglib.installation.html
    • /usr/share/doc/php-manual-en/ktaglib.requirements.html
    • /usr/share/doc/php-manual-en/ktaglib.setup.html
    • /usr/share/doc/php-manual-en/langref.html
    • /usr/share/doc/php-manual-en/language.basic-syntax.comments.html
    • /usr/share/doc/php-manual-en/language.basic-syntax.html
    • /usr/share/doc/php-manual-en/language.basic-syntax.instruction-separation.html
    • /usr/share/doc/php-manual-en/language.basic-syntax.phpmode.html
    • /usr/share/doc/php-manual-en/language.basic-syntax.phptags.html
    • /usr/share/doc/php-manual-en/language.constants.html
    • /usr/share/doc/php-manual-en/language.constants.predefined.html
    • /usr/share/doc/php-manual-en/language.constants.syntax.html
    • /usr/share/doc/php-manual-en/language.control-structures.html
    • /usr/share/doc/php-manual-en/language.exceptions.extending.html
    • /usr/share/doc/php-manual-en/language.exceptions.html
    • /usr/share/doc/php-manual-en/language.expressions.html
    • /usr/share/doc/php-manual-en/language.functions.html
    • /usr/share/doc/php-manual-en/language.generators.comparison.html
    • /usr/share/doc/php-manual-en/language.generators.html
    • /usr/share/doc/php-manual-en/language.generators.overview.html
    • /usr/share/doc/php-manual-en/language.generators.syntax.html
    • /usr/share/doc/php-manual-en/language.namespaces.basics.html
    • /usr/share/doc/php-manual-en/language.namespaces.definition.html
    • /usr/share/doc/php-manual-en/language.namespaces.definitionmultiple.html
    • /usr/share/doc/php-manual-en/language.namespaces.dynamic.html
    • /usr/share/doc/php-manual-en/language.namespaces.fallback.html
    • /usr/share/doc/php-manual-en/language.namespaces.faq.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/language.namespaces.html
    • /usr/share/doc/php-manual-en/language.namespaces.importing.html
    • /usr/share/doc/php-manual-en/language.namespaces.nested.html
    • /usr/share/doc/php-manual-en/language.namespaces.nsconstants.html
    • /usr/share/doc/php-manual-en/language.namespaces.rationale.html
    • /usr/share/doc/php-manual-en/language.namespaces.rules.html
    • /usr/share/doc/php-manual-en/language.oop5.abstract.html
    • /usr/share/doc/php-manual-en/language.oop5.autoload.html
    • /usr/share/doc/php-manual-en/language.oop5.basic.html
    • /usr/share/doc/php-manual-en/language.oop5.changelog.html
    • /usr/share/doc/php-manual-en/language.oop5.cloning.html
    • /usr/share/doc/php-manual-en/language.oop5.constants.html
    • /usr/share/doc/php-manual-en/language.oop5.decon.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/language.oop5.html
    • /usr/share/doc/php-manual-en/language.oop5.inheritance.html
    • /usr/share/doc/php-manual-en/language.oop5.interfaces.html
    • /usr/share/doc/php-manual-en/language.oop5.iterations.html
    • /usr/share/doc/php-manual-en/language.oop5.late-static-bindings.html
    • /usr/share/doc/php-manual-en/language.oop5.magic.html
    • /usr/share/doc/php-manual-en/language.oop5.object-comparison.html
    • /usr/share/doc/php-manual-en/language.oop5.overloading.html
    • /usr/share/doc/php-manual-en/language.oop5.paamayim-nekudotayim.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/language.oop5.references.html
    • /usr/share/doc/php-manual-en/language.oop5.serialization.html
    • /usr/share/doc/php-manual-en/language.oop5.static.html
    • /usr/share/doc/php-manual-en/language.oop5.traits.html
    • /usr/share/doc/php-manual-en/language.oop5.typehinting.html
    • /usr/share/doc/php-manual-en/language.oop5.visibility.html
    • /usr/share/doc/php-manual-en/language.operators.arithmetic.html
    • /usr/share/doc/php-manual-en/language.operators.array.html
    • /usr/share/doc/php-manual-en/language.operators.assignment.html
    • /usr/share/doc/php-manual-en/language.operators.bitwise.html
    • /usr/share/doc/php-manual-en/language.operators.comparison.html
    • /usr/share/doc/php-manual-en/language.operators.errorcontrol.html
    • /usr/share/doc/php-manual-en/language.operators.execution.html
    • /usr/share/doc/php-manual-en/language.operators.html
    • /usr/share/doc/php-manual-en/language.operators.increment.html
    • /usr/share/doc/php-manual-en/language.operators.logical.html
    • /usr/share/doc/php-manual-en/language.operators.precedence.html
    • /usr/share/doc/php-manual-en/language.operators.string.html
    • /usr/share/doc/php-manual-en/language.operators.type.html
    • /usr/share/doc/php-manual-en/language.pseudo-types.html
    • /usr/share/doc/php-manual-en/language.references.arent.html
    • /usr/share/doc/php-manual-en/language.references.html
    • /usr/share/doc/php-manual-en/language.references.pass.html
    • /usr/share/doc/php-manual-en/language.references.return.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/language.references.unset.html
    • /usr/share/doc/php-manual-en/language.references.whatare.html
    • /usr/share/doc/php-manual-en/language.references.whatdo.html
    • /usr/share/doc/php-manual-en/language.types.array.html
    • /usr/share/doc/php-manual-en/language.types.boolean.html
    • /usr/share/doc/php-manual-en/language.types.callable.html
    • /usr/share/doc/php-manual-en/language.types.float.html
    • /usr/share/doc/php-manual-en/language.types.html
    • /usr/share/doc/php-manual-en/language.types.integer.html
    • /usr/share/doc/php-manual-en/language.types.intro.html
    • /usr/share/doc/php-manual-en/language.types.null.html
    • /usr/share/doc/php-manual-en/language.types.object.html
    • /usr/share/doc/php-manual-en/language.types.resource.html
    • /usr/share/doc/php-manual-en/language.types.string.html
    • /usr/share/doc/php-manual-en/language.types.type-juggling.html
    • /usr/share/doc/php-manual-en/language.variables.basics.html
    • /usr/share/doc/php-manual-en/language.variables.external.html
    • /usr/share/doc/php-manual-en/language.variables.html
    • /usr/share/doc/php-manual-en/language.variables.predefined.html
    • /usr/share/doc/php-manual-en/language.variables.scope.html
    • /usr/share/doc/php-manual-en/language.variables.superglobals.html
    • /usr/share/doc/php-manual-en/language.variables.variable.html
    • /usr/share/doc/php-manual-en/lapack.configuration.html
    • /usr/share/doc/php-manual-en/lapack.constants.html
    • /usr/share/doc/php-manual-en/lapack.eigenvalues.html
    • /usr/share/doc/php-manual-en/lapack.identity.html
    • /usr/share/doc/php-manual-en/lapack.installation.html
    • /usr/share/doc/php-manual-en/lapack.leastsquaresbyfactorisation.html
    • /usr/share/doc/php-manual-en/lapack.leastsquaresbysvd.html
    • /usr/share/doc/php-manual-en/lapack.pseudoinverse.html
    • /usr/share/doc/php-manual-en/lapack.requirements.html
    • /usr/share/doc/php-manual-en/lapack.resources.html
    • /usr/share/doc/php-manual-en/lapack.setup.html
    • /usr/share/doc/php-manual-en/lapack.singularvalues.html
    • /usr/share/doc/php-manual-en/lapack.solvelinearequation.html
    • /usr/share/doc/php-manual-en/ldap.configuration.html
    • /usr/share/doc/php-manual-en/ldap.constants.html
    • /usr/share/doc/php-manual-en/ldap.examples-basic.html
    • /usr/share/doc/php-manual-en/ldap.examples.html
    • /usr/share/doc/php-manual-en/ldap.installation.html
    • /usr/share/doc/php-manual-en/ldap.requirements.html
    • /usr/share/doc/php-manual-en/ldap.resources.html
    • /usr/share/doc/php-manual-en/ldap.setup.html
    • /usr/share/doc/php-manual-en/ldap.using.html
    • /usr/share/doc/php-manual-en/libevent.configuration.html
    • /usr/share/doc/php-manual-en/libevent.constants.html
    • /usr/share/doc/php-manual-en/libevent.examples.html
    • /usr/share/doc/php-manual-en/libevent.installation.html
    • /usr/share/doc/php-manual-en/libevent.requirements.html
    • /usr/share/doc/php-manual-en/libevent.resources.html
    • /usr/share/doc/php-manual-en/libevent.setup.html
    • /usr/share/doc/php-manual-en/libxml.configuration.html
    • /usr/share/doc/php-manual-en/libxml.constants.html
    • /usr/share/doc/php-manual-en/libxml.installation.html
    • /usr/share/doc/php-manual-en/libxml.requirements.html
    • /usr/share/doc/php-manual-en/libxml.resources.html
    • /usr/share/doc/php-manual-en/libxml.setup.html
    • /usr/share/doc/php-manual-en/limititerator.construct.html
    • /usr/share/doc/php-manual-en/limititerator.current.html
    • /usr/share/doc/php-manual-en/limititerator.getinneriterator.html
    • /usr/share/doc/php-manual-en/limititerator.getposition.html
    • /usr/share/doc/php-manual-en/limititerator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/limititerator.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/limititerator.valid.html
    • /usr/share/doc/php-manual-en/locale.acceptfromhttp.html
    • /usr/share/doc/php-manual-en/locale.canonicalize.html
    • /usr/share/doc/php-manual-en/locale.composelocale.html
    • /usr/share/doc/php-manual-en/locale.filtermatches.html
    • /usr/share/doc/php-manual-en/locale.getallvariants.html
    • /usr/share/doc/php-manual-en/locale.getdefault.html
    • /usr/share/doc/php-manual-en/locale.getdisplaylanguage.html
    • /usr/share/doc/php-manual-en/locale.getdisplayname.html
    • /usr/share/doc/php-manual-en/locale.getdisplayregion.html
    • /usr/share/doc/php-manual-en/locale.getdisplayscript.html
    • /usr/share/doc/php-manual-en/locale.getdisplayvariant.html
    • /usr/share/doc/php-manual-en/locale.getkeywords.html
    • /usr/share/doc/php-manual-en/locale.getprimarylanguage.html
    • /usr/share/doc/php-manual-en/locale.getregion.html
    • /usr/share/doc/php-manual-en/locale.getscript.html
    • /usr/share/doc/php-manual-en/locale.lookup.html
    • /usr/share/doc/php-manual-en/locale.parselocale.html
    • /usr/share/doc/php-manual-en/locale.setdefault.html
    • /usr/share/doc/php-manual-en/lua.assign.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/lua.configuration.html
    • /usr/share/doc/php-manual-en/lua.construct.html
    • /usr/share/doc/php-manual-en/lua.eval.html
    • /usr/share/doc/php-manual-en/lua.getversion.html
    • /usr/share/doc/php-manual-en/lua.include.html
    • /usr/share/doc/php-manual-en/lua.installation.html
    • /usr/share/doc/php-manual-en/lua.registercallback.html
    • /usr/share/doc/php-manual-en/lua.requirements.html
    • /usr/share/doc/php-manual-en/lua.resources.html
    • /usr/share/doc/php-manual-en/lua.setup.html
    • /usr/share/doc/php-manual-en/luaclosure.invoke.html
    • /usr/share/doc/php-manual-en/lzf.configuration.html
    • /usr/share/doc/php-manual-en/lzf.constants.html
    • /usr/share/doc/php-manual-en/lzf.installation.html
    • /usr/share/doc/php-manual-en/lzf.requirements.html
    • /usr/share/doc/php-manual-en/lzf.resources.html
    • /usr/share/doc/php-manual-en/lzf.setup.html
    • /usr/share/doc/php-manual-en/mail.configuration.html
    • /usr/share/doc/php-manual-en/mail.constants.html
    • /usr/share/doc/php-manual-en/mail.installation.html
    • /usr/share/doc/php-manual-en/mail.requirements.html
    • /usr/share/doc/php-manual-en/mail.resources.html
    • /usr/share/doc/php-manual-en/mail.setup.html
    • /usr/share/doc/php-manual-en/mailparse.configuration.html
    • /usr/share/doc/php-manual-en/mailparse.constants.html
    • /usr/share/doc/php-manual-en/mailparse.installation.html
    • /usr/share/doc/php-manual-en/mailparse.requirements.html
    • /usr/share/doc/php-manual-en/mailparse.resources.html
    • /usr/share/doc/php-manual-en/mailparse.setup.html
    • /usr/share/doc/php-manual-en/manual.html
    • /usr/share/doc/php-manual-en/math.configuration.html
    • /usr/share/doc/php-manual-en/math.constants.html
    • /usr/share/doc/php-manual-en/math.installation.html
    • /usr/share/doc/php-manual-en/math.requirements.html
    • /usr/share/doc/php-manual-en/math.resources.html
    • /usr/share/doc/php-manual-en/math.setup.html
    • /usr/share/doc/php-manual-en/maxdb.configuration.html
    • /usr/share/doc/php-manual-en/maxdb.constants.html
    • /usr/share/doc/php-manual-en/maxdb.examples-basic.html
    • /usr/share/doc/php-manual-en/maxdb.examples.html
    • /usr/share/doc/php-manual-en/maxdb.installation.html
    • /usr/share/doc/php-manual-en/maxdb.requirements.html
    • /usr/share/doc/php-manual-en/maxdb.resources.html
    • /usr/share/doc/php-manual-en/maxdb.setup.html
    • /usr/share/doc/php-manual-en/mbstring.configuration.html
    • /usr/share/doc/php-manual-en/mbstring.constants.html
    • /usr/share/doc/php-manual-en/mbstring.encodings.html
    • /usr/share/doc/php-manual-en/mbstring.http.html
    • /usr/share/doc/php-manual-en/mbstring.installation.html
    • /usr/share/doc/php-manual-en/mbstring.ja-basic.html
    • /usr/share/doc/php-manual-en/mbstring.overload.html
    • /usr/share/doc/php-manual-en/mbstring.php4.req.html
    • /usr/share/doc/php-manual-en/mbstring.requirements.html
    • /usr/share/doc/php-manual-en/mbstring.resources.html
    • /usr/share/doc/php-manual-en/mbstring.setup.html
    • /usr/share/doc/php-manual-en/mbstring.supported-encodings.html
    • /usr/share/doc/php-manual-en/mcrypt.ciphers.html
    • /usr/share/doc/php-manual-en/mcrypt.configuration.html
    • /usr/share/doc/php-manual-en/mcrypt.constants.html
    • /usr/share/doc/php-manual-en/mcrypt.examples.html
    • /usr/share/doc/php-manual-en/mcrypt.installation.html
    • /usr/share/doc/php-manual-en/mcrypt.requirements.html
    • /usr/share/doc/php-manual-en/mcrypt.resources.html
    • /usr/share/doc/php-manual-en/mcrypt.setup.html
    • /usr/share/doc/php-manual-en/mcve.configuration.html
    • /usr/share/doc/php-manual-en/mcve.constants.html
    • /usr/share/doc/php-manual-en/mcve.installation.html
    • /usr/share/doc/php-manual-en/mcve.requirements.html
    • /usr/share/doc/php-manual-en/mcve.resources.html
    • /usr/share/doc/php-manual-en/mcve.setup.html
    • /usr/share/doc/php-manual-en/memcache.add.html
    • /usr/share/doc/php-manual-en/memcache.addserver.html
    • /usr/share/doc/php-manual-en/memcache.close.html
    • /usr/share/doc/php-manual-en/memcache.connect.html
    • /usr/share/doc/php-manual-en/memcache.constants.html
    • /usr/share/doc/php-manual-en/memcache.decrement.html
    • /usr/share/doc/php-manual-en/memcache.delete.html
    • /usr/share/doc/php-manual-en/memcache.examples-overview.html
    • /usr/share/doc/php-manual-en/memcache.examples.html
    • /usr/share/doc/php-manual-en/memcache.flush.html
    • /usr/share/doc/php-manual-en/memcache.get.html
    • /usr/share/doc/php-manual-en/memcache.getextendedstats.html
    • /usr/share/doc/php-manual-en/memcache.getserverstatus.html
    • /usr/share/doc/php-manual-en/memcache.getstats.html
    • /usr/share/doc/php-manual-en/memcache.getversion.html
    • /usr/share/doc/php-manual-en/memcache.increment.html
    • /usr/share/doc/php-manual-en/memcache.ini.html
    • /usr/share/doc/php-manual-en/memcache.installation.html
    • /usr/share/doc/php-manual-en/memcache.pconnect.html
    • /usr/share/doc/php-manual-en/memcache.replace.html
    • /usr/share/doc/php-manual-en/memcache.requirements.html
    • /usr/share/doc/php-manual-en/memcache.resources.html
    • /usr/share/doc/php-manual-en/memcache.set.html
    • /usr/share/doc/php-manual-en/memcache.setcompressthreshold.html
    • /usr/share/doc/php-manual-en/memcache.setserverparams.html
    • /usr/share/doc/php-manual-en/memcache.setup.html
    • /usr/share/doc/php-manual-en/memcached.add.html
    • /usr/share/doc/php-manual-en/memcached.addbykey.html
    • /usr/share/doc/php-manual-en/memcached.addserver.html
    • /usr/share/doc/php-manual-en/memcached.addservers.html
    • /usr/share/doc/php-manual-en/memcached.append.html
    • /usr/share/doc/php-manual-en/memcached.appendbykey.html
    • /usr/share/doc/php-manual-en/memcached.callbacks.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/memcached.callbacks.result.html
    • /usr/share/doc/php-manual-en/memcached.cas.html
    • /usr/share/doc/php-manual-en/memcached.casbykey.html
    • /usr/share/doc/php-manual-en/memcached.configuration.html
    • /usr/share/doc/php-manual-en/memcached.constants.html
    • /usr/share/doc/php-manual-en/memcached.construct.html
    • /usr/share/doc/php-manual-en/memcached.decrement.html
    • /usr/share/doc/php-manual-en/memcached.decrementbykey.html
    • /usr/share/doc/php-manual-en/memcached.delete.html
    • /usr/share/doc/php-manual-en/memcached.deletebykey.html
    • /usr/share/doc/php-manual-en/memcached.deletemulti.html
    • /usr/share/doc/php-manual-en/memcached.deletemultibykey.html
    • /usr/share/doc/php-manual-en/memcached.expiration.html
    • /usr/share/doc/php-manual-en/memcached.fetch.html
    • /usr/share/doc/php-manual-en/memcached.fetchall.html
    • /usr/share/doc/php-manual-en/memcached.flush.html
    • /usr/share/doc/php-manual-en/memcached.get.html
    • /usr/share/doc/php-manual-en/memcached.getallkeys.html
    • /usr/share/doc/php-manual-en/memcached.getbykey.html
    • /usr/share/doc/php-manual-en/memcached.getdelayed.html
    • /usr/share/doc/php-manual-en/memcached.getdelayedbykey.html
    • /usr/share/doc/php-manual-en/memcached.getmulti.html
    • /usr/share/doc/php-manual-en/memcached.getmultibykey.html
    • /usr/share/doc/php-manual-en/memcached.getoption.html
    • /usr/share/doc/php-manual-en/memcached.getresultcode.html
    • /usr/share/doc/php-manual-en/memcached.getresultmessage.html
    • /usr/share/doc/php-manual-en/memcached.getserverbykey.html
    • /usr/share/doc/php-manual-en/memcached.getserverlist.html
    • /usr/share/doc/php-manual-en/memcached.getstats.html
    • /usr/share/doc/php-manual-en/memcached.getversion.html
    • /usr/share/doc/php-manual-en/memcached.increment.html
    • /usr/share/doc/php-manual-en/memcached.incrementbykey.html
    • /usr/share/doc/php-manual-en/memcached.installation.html
    • /usr/share/doc/php-manual-en/memcached.ispersistent.html
    • /usr/share/doc/php-manual-en/memcached.ispristine.html
    • /usr/share/doc/php-manual-en/memcached.prepend.html
    • /usr/share/doc/php-manual-en/memcached.prependbykey.html
    • /usr/share/doc/php-manual-en/memcached.quit.html
    • /usr/share/doc/php-manual-en/memcached.replace.html
    • /usr/share/doc/php-manual-en/memcached.replacebykey.html
    • /usr/share/doc/php-manual-en/memcached.requirements.html
    • /usr/share/doc/php-manual-en/memcached.resetserverlist.html
    • /usr/share/doc/php-manual-en/memcached.resources.html
    • /usr/share/doc/php-manual-en/memcached.sessions.html
    • /usr/share/doc/php-manual-en/memcached.set.html
    • /usr/share/doc/php-manual-en/memcached.setbykey.html
    • /usr/share/doc/php-manual-en/memcached.setmulti.html
    • /usr/share/doc/php-manual-en/memcached.setmultibykey.html
    • /usr/share/doc/php-manual-en/memcached.setoption.html
    • /usr/share/doc/php-manual-en/memcached.setoptions.html
    • /usr/share/doc/php-manual-en/memcached.setsaslauthdata.html
    • /usr/share/doc/php-manual-en/memcached.setup.html
    • /usr/share/doc/php-manual-en/memcached.touch.html
    • /usr/share/doc/php-manual-en/memcached.touchbykey.html
    • /usr/share/doc/php-manual-en/memtrack.constants.html
    • /usr/share/doc/php-manual-en/memtrack.examples.basic.html
    • /usr/share/doc/php-manual-en/memtrack.examples.html
    • /usr/share/doc/php-manual-en/memtrack.ini.html
    • /usr/share/doc/php-manual-en/memtrack.installation.html
    • /usr/share/doc/php-manual-en/memtrack.requirements.html
    • /usr/share/doc/php-manual-en/memtrack.resources.html
    • /usr/share/doc/php-manual-en/memtrack.setup.html
    • /usr/share/doc/php-manual-en/messageformatter.create.html
    • /usr/share/doc/php-manual-en/messageformatter.format.html
    • /usr/share/doc/php-manual-en/messageformatter.formatmessage.html
    • /usr/share/doc/php-manual-en/messageformatter.geterrorcode.html
    • /usr/share/doc/php-manual-en/messageformatter.geterrormessage.html
    • /usr/share/doc/php-manual-en/messageformatter.getlocale.html
    • /usr/share/doc/php-manual-en/messageformatter.getpattern.html
    • /usr/share/doc/php-manual-en/messageformatter.parse.html
    • /usr/share/doc/php-manual-en/messageformatter.parsemessage.html
    • /usr/share/doc/php-manual-en/messageformatter.setpattern.html
    • /usr/share/doc/php-manual-en/mhash.configuration.html
    • /usr/share/doc/php-manual-en/mhash.constants.html
    • /usr/share/doc/php-manual-en/mhash.examples.html
    • /usr/share/doc/php-manual-en/mhash.installation.html
    • /usr/share/doc/php-manual-en/mhash.requirements.html
    • /usr/share/doc/php-manual-en/mhash.resources.html
    • /usr/share/doc/php-manual-en/mhash.setup.html
    • /usr/share/doc/php-manual-en/migrating5.errorrep.html
    • /usr/share/doc/php-manual-en/migration5.changes.html
    • /usr/share/doc/php-manual-en/migration5.cli-cgi.html
    • /usr/share/doc/php-manual-en/migration5.configuration.html
    • /usr/share/doc/php-manual-en/migration5.databases.html
    • /usr/share/doc/php-manual-en/migration5.functions.html
    • /usr/share/doc/php-manual-en/migration5.html
    • /usr/share/doc/php-manual-en/migration5.incompatible.html
    • /usr/share/doc/php-manual-en/migration5.newconf.html
    • /usr/share/doc/php-manual-en/migration5.oop.html
    • /usr/share/doc/php-manual-en/migration51.changes.html
    • /usr/share/doc/php-manual-en/migration51.databases.html
    • /usr/share/doc/php-manual-en/migration51.datetime.html
    • /usr/share/doc/php-manual-en/migration51.errorcheck.html
    • /usr/share/doc/php-manual-en/migration51.extensions.html
    • /usr/share/doc/php-manual-en/migration51.html
    • /usr/share/doc/php-manual-en/migration51.integer-parameters.html
    • /usr/share/doc/php-manual-en/migration51.oop.html
    • /usr/share/doc/php-manual-en/migration51.reading.html
    • /usr/share/doc/php-manual-en/migration51.references.html
    • /usr/share/doc/php-manual-en/migration52.changes.html
    • /usr/share/doc/php-manual-en/migration52.class-constants.html
    • /usr/share/doc/php-manual-en/migration52.classes.html
    • /usr/share/doc/php-manual-en/migration52.datetime.html
    • /usr/share/doc/php-manual-en/migration52.error-messages.html
    • /usr/share/doc/php-manual-en/migration52.errorrep.html
    • /usr/share/doc/php-manual-en/migration52.functions.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration52.html
    • /usr/share/doc/php-manual-en/migration52.incompatible.html
    • /usr/share/doc/php-manual-en/migration52.methods.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration52.newconf.html
    • /usr/share/doc/php-manual-en/migration52.other.html
    • /usr/share/doc/php-manual-en/migration52.parameters.html
    • /usr/share/doc/php-manual-en/migration52.removed-extensions.html
    • /usr/share/doc/php-manual-en/migration53.changes.html
    • /usr/share/doc/php-manual-en/migration53.class-constants.html
    • /usr/share/doc/php-manual-en/migration53.classes.html
    • /usr/share/doc/php-manual-en/migration53.deprecated.html
    • /usr/share/doc/php-manual-en/migration53.extensions-other.html
    • /usr/share/doc/php-manual-en/migration53.functions.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration53.html
    • /usr/share/doc/php-manual-en/migration53.incompatible.html
    • /usr/share/doc/php-manual-en/migration53.ini.html
    • /usr/share/doc/php-manual-en/migration53.methods.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration53.other.html
    • /usr/share/doc/php-manual-en/migration53.parameters.html
    • /usr/share/doc/php-manual-en/migration53.removed-extensions.html
    • /usr/share/doc/php-manual-en/migration53.sapi.html
    • /usr/share/doc/php-manual-en/migration53.undeprecated.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration54.changes.html
    • /usr/share/doc/php-manual-en/migration54.classes.html
    • /usr/share/doc/php-manual-en/migration54.deprecated.html
    • /usr/share/doc/php-manual-en/migration54.extensions-other.html
    • /usr/share/doc/php-manual-en/migration54.functions.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration54.html
    • /usr/share/doc/php-manual-en/migration54.incompatible.html
    • /usr/share/doc/php-manual-en/migration54.ini.html
    • /usr/share/doc/php-manual-en/migration54.methods.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration54.other.html
    • /usr/share/doc/php-manual-en/migration54.parameters.html
    • /usr/share/doc/php-manual-en/migration54.removed-extensions.html
    • /usr/share/doc/php-manual-en/migration54.sapi.html
    • /usr/share/doc/php-manual-en/migration55.changed-functions.html
    • /usr/share/doc/php-manual-en/migration55.changes.html
    • /usr/share/doc/php-manual-en/migration55.classes.html
    • /usr/share/doc/php-manual-en/migration55.deprecated.html
    • /usr/share/doc/php-manual-en/migration55.extensions-other.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/migration55.html
    • /usr/share/doc/php-manual-en/migration55.incompatible.html
    • /usr/share/doc/php-manual-en/migration55.ini.html
    • /usr/share/doc/php-manual-en/migration55.internals.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mime-magic.configuration.html
    • /usr/share/doc/php-manual-en/mime-magic.constants.html
    • /usr/share/doc/php-manual-en/mime-magic.installation.html
    • /usr/share/doc/php-manual-en/mime-magic.requirements.html
    • /usr/share/doc/php-manual-en/mime-magic.resources.html
    • /usr/share/doc/php-manual-en/mime-magic.setup.html
    • /usr/share/doc/php-manual-en/ming.configuration.html
    • /usr/share/doc/php-manual-en/ming.constants.html
    • /usr/share/doc/php-manual-en/ming.examples.html
    • /usr/share/doc/php-manual-en/ming.examples.swfaction.html
    • /usr/share/doc/php-manual-en/ming.examples.swfsprite-basic.html
    • /usr/share/doc/php-manual-en/ming.install.html
    • /usr/share/doc/php-manual-en/ming.requirements.html
    • /usr/share/doc/php-manual-en/ming.resources.html
    • /usr/share/doc/php-manual-en/ming.setup.html
    • /usr/share/doc/php-manual-en/misc.configuration.html
    • /usr/share/doc/php-manual-en/misc.constants.html
    • /usr/share/doc/php-manual-en/misc.installation.html
    • /usr/share/doc/php-manual-en/misc.requirements.html
    • /usr/share/doc/php-manual-en/misc.resources.html
    • /usr/share/doc/php-manual-en/misc.setup.html
    • /usr/share/doc/php-manual-en/mnogosearch.configuration.html
    • /usr/share/doc/php-manual-en/mnogosearch.constants.html
    • /usr/share/doc/php-manual-en/mnogosearch.installation.html
    • /usr/share/doc/php-manual-en/mnogosearch.requirements.html
    • /usr/share/doc/php-manual-en/mnogosearch.resources.html
    • /usr/share/doc/php-manual-en/mnogosearch.setup.html
    • /usr/share/doc/php-manual-en/mongo.configuration.html
    • /usr/share/doc/php-manual-en/mongo.connecting.auth.html
    • /usr/share/doc/php-manual-en/mongo.connecting.html
    • /usr/share/doc/php-manual-en/mongo.connecting.mongos.html
    • /usr/share/doc/php-manual-en/mongo.connecting.persistent.html
    • /usr/share/doc/php-manual-en/mongo.connecting.pools.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongo.connecting.uds.html
    • /usr/share/doc/php-manual-en/mongo.connectutil.html
    • /usr/share/doc/php-manual-en/mongo.construct.html
    • /usr/share/doc/php-manual-en/mongo.core.html
    • /usr/share/doc/php-manual-en/mongo.exceptions.html
    • /usr/share/doc/php-manual-en/mongo.getpoolsize.html
    • /usr/share/doc/php-manual-en/mongo.getslave.html
    • /usr/share/doc/php-manual-en/mongo.getslaveokay.html
    • /usr/share/doc/php-manual-en/mongo.gridfs.html
    • /usr/share/doc/php-manual-en/mongo.installation.html
    • /usr/share/doc/php-manual-en/mongo.manual.html
    • /usr/share/doc/php-manual-en/mongo.miscellaneous.html
    • /usr/share/doc/php-manual-en/mongo.pooldebug.html
    • /usr/share/doc/php-manual-en/mongo.queries.html
    • /usr/share/doc/php-manual-en/mongo.readpreferences.html
    • /usr/share/doc/php-manual-en/mongo.requirements.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongo.setpoolsize.html
    • /usr/share/doc/php-manual-en/mongo.setslaveokay.html
    • /usr/share/doc/php-manual-en/mongo.setup.html
    • /usr/share/doc/php-manual-en/mongo.sqltomongo.html
    • /usr/share/doc/php-manual-en/mongo.switchslave.html
    • /usr/share/doc/php-manual-en/mongo.testing.html
    • /usr/share/doc/php-manual-en/mongo.trouble.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.collection.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.connecting.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.counting.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.criteria.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.cursor.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.findone.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.indexes.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.insert.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.insert.multiple.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.multi.query.html
    • /usr/share/doc/php-manual-en/mongo.tutorial.selectdb.html
    • /usr/share/doc/php-manual-en/mongo.types.html
    • /usr/share/doc/php-manual-en/mongo.updates.html
    • /usr/share/doc/php-manual-en/mongo.writeconcerns.html
    • /usr/share/doc/php-manual-en/mongo.writes.html
    • /usr/share/doc/php-manual-en/mongobindata.construct.html
    • /usr/share/doc/php-manual-en/mongobindata.tostring.html
    • /usr/share/doc/php-manual-en/mongoclient.close.html
    • /usr/share/doc/php-manual-en/mongoclient.connect.html
    • /usr/share/doc/php-manual-en/mongoclient.construct.html
    • /usr/share/doc/php-manual-en/mongoclient.dropdb.html
    • /usr/share/doc/php-manual-en/mongoclient.get.html
    • /usr/share/doc/php-manual-en/mongoclient.getconnections.html
    • /usr/share/doc/php-manual-en/mongoclient.gethosts.html
    • /usr/share/doc/php-manual-en/mongoclient.getreadpreference.html
    • /usr/share/doc/php-manual-en/mongoclient.killcursor.html
    • /usr/share/doc/php-manual-en/mongoclient.listdbs.html
    • /usr/share/doc/php-manual-en/mongoclient.selectcollection.html
    • /usr/share/doc/php-manual-en/mongoclient.selectdb.html
    • /usr/share/doc/php-manual-en/mongoclient.setreadpreference.html
    • /usr/share/doc/php-manual-en/mongoclient.tostring.html
    • /usr/share/doc/php-manual-en/mongocode.construct.html
    • /usr/share/doc/php-manual-en/mongocode.tostring.html
    • /usr/share/doc/php-manual-en/mongocollection.--tostring.html
    • /usr/share/doc/php-manual-en/mongocollection.aggregate.html
    • /usr/share/doc/php-manual-en/mongocollection.batchinsert.html
    • /usr/share/doc/php-manual-en/mongocollection.construct.html
    • /usr/share/doc/php-manual-en/mongocollection.count.html
    • /usr/share/doc/php-manual-en/mongocollection.createdbref.html
    • /usr/share/doc/php-manual-en/mongocollection.deleteindex.html
    • /usr/share/doc/php-manual-en/mongocollection.deleteindexes.html
    • /usr/share/doc/php-manual-en/mongocollection.distinct.html
    • /usr/share/doc/php-manual-en/mongocollection.drop.html
    • /usr/share/doc/php-manual-en/mongocollection.ensureindex.html
    • /usr/share/doc/php-manual-en/mongocollection.find.html
    • /usr/share/doc/php-manual-en/mongocollection.findandmodify.html
    • /usr/share/doc/php-manual-en/mongocollection.findone.html
    • /usr/share/doc/php-manual-en/mongocollection.get.html
    • /usr/share/doc/php-manual-en/mongocollection.getdbref.html
    • /usr/share/doc/php-manual-en/mongocollection.getindexinfo.html
    • /usr/share/doc/php-manual-en/mongocollection.getname.html
    • /usr/share/doc/php-manual-en/mongocollection.getreadpreference.html
    • /usr/share/doc/php-manual-en/mongocollection.getslaveokay.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongocollection.insert.html
    • /usr/share/doc/php-manual-en/mongocollection.remove.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongocollection.setreadpreference.html
    • /usr/share/doc/php-manual-en/mongocollection.setslaveokay.html
    • /usr/share/doc/php-manual-en/mongocollection.toindexstring.html
    • /usr/share/doc/php-manual-en/mongocollection.update.html
    • /usr/share/doc/php-manual-en/mongocollection.validate.html
    • /usr/share/doc/php-manual-en/mongocursor.addoption.html
    • /usr/share/doc/php-manual-en/mongocursor.awaitdata.html
    • /usr/share/doc/php-manual-en/mongocursor.batchsize.html
    • /usr/share/doc/php-manual-en/mongocursor.construct.html
    • /usr/share/doc/php-manual-en/mongocursor.count.html
    • /usr/share/doc/php-manual-en/mongocursor.current.html
    • /usr/share/doc/php-manual-en/mongocursor.dead.html
    • /usr/share/doc/php-manual-en/mongocursor.doquery.html
    • /usr/share/doc/php-manual-en/mongocursor.explain.html
    • /usr/share/doc/php-manual-en/mongocursor.fields.html
    • /usr/share/doc/php-manual-en/mongocursor.getnext.html
    • /usr/share/doc/php-manual-en/mongocursor.getreadpreference.html
    • /usr/share/doc/php-manual-en/mongocursor.hasnext.html
    • /usr/share/doc/php-manual-en/mongocursor.hint.html
    • /usr/share/doc/php-manual-en/mongocursor.immortal.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongocursor.key.html
    • /usr/share/doc/php-manual-en/mongocursor.limit.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongocursor.partial.html
    • /usr/share/doc/php-manual-en/mongocursor.reset.html
    • /usr/share/doc/php-manual-en/mongocursor.rewind.html
    • /usr/share/doc/php-manual-en/mongocursor.setflag.html
    • /usr/share/doc/php-manual-en/mongocursor.setreadpreference.html
    • /usr/share/doc/php-manual-en/mongocursor.skip.html
    • /usr/share/doc/php-manual-en/mongocursor.slaveokay.html
    • /usr/share/doc/php-manual-en/mongocursor.snapshot.html
    • /usr/share/doc/php-manual-en/mongocursor.sort.html
    • /usr/share/doc/php-manual-en/mongocursor.tailable.html
    • /usr/share/doc/php-manual-en/mongocursor.timeout.html
    • /usr/share/doc/php-manual-en/mongocursor.valid.html
    • /usr/share/doc/php-manual-en/mongocursorexception.gethost.html
    • /usr/share/doc/php-manual-en/mongodate.construct.html
    • /usr/share/doc/php-manual-en/mongodate.tostring.html
    • /usr/share/doc/php-manual-en/mongodb.--tostring.html
    • /usr/share/doc/php-manual-en/mongodb.authenticate.html
    • /usr/share/doc/php-manual-en/mongodb.command.html
    • /usr/share/doc/php-manual-en/mongodb.construct.html
    • /usr/share/doc/php-manual-en/mongodb.createcollection.html
    • /usr/share/doc/php-manual-en/mongodb.createdbref.html
    • /usr/share/doc/php-manual-en/mongodb.drop.html
    • /usr/share/doc/php-manual-en/mongodb.dropcollection.html
    • /usr/share/doc/php-manual-en/mongodb.execute.html
    • /usr/share/doc/php-manual-en/mongodb.forceerror.html
    • /usr/share/doc/php-manual-en/mongodb.get.html
    • /usr/share/doc/php-manual-en/mongodb.getcollectionnames.html
    • /usr/share/doc/php-manual-en/mongodb.getdbref.html
    • /usr/share/doc/php-manual-en/mongodb.getgridfs.html
    • /usr/share/doc/php-manual-en/mongodb.getprofilinglevel.html
    • /usr/share/doc/php-manual-en/mongodb.getreadpreference.html
    • /usr/share/doc/php-manual-en/mongodb.getslaveokay.html
    • /usr/share/doc/php-manual-en/mongodb.lasterror.html
    • /usr/share/doc/php-manual-en/mongodb.listcollections.html
    • /usr/share/doc/php-manual-en/mongodb.preverror.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongodb.reseterror.html
    • /usr/share/doc/php-manual-en/mongodb.selectcollection.html
    • /usr/share/doc/php-manual-en/mongodb.setprofilinglevel.html
    • /usr/share/doc/php-manual-en/mongodb.setreadpreference.html
    • /usr/share/doc/php-manual-en/mongodb.setslaveokay.html
    • /usr/share/doc/php-manual-en/mongodbref.create.html
    • /usr/share/doc/php-manual-en/mongodbref.get.html
    • /usr/share/doc/php-manual-en/mongodbref.isref.html
    • /usr/share/doc/php-manual-en/mongogridfs.construct.html
    • /usr/share/doc/php-manual-en/mongogridfs.delete.html
    • /usr/share/doc/php-manual-en/mongogridfs.drop.html
    • /usr/share/doc/php-manual-en/mongogridfs.find.html
    • /usr/share/doc/php-manual-en/mongogridfs.findone.html
    • /usr/share/doc/php-manual-en/mongogridfs.get.html
    • /usr/share/doc/php-manual-en/mongogridfs.put.html
    • /usr/share/doc/php-manual-en/mongogridfs.remove.html
    • /usr/share/doc/php-manual-en/mongogridfs.storebytes.html
    • /usr/share/doc/php-manual-en/mongogridfs.storefile.html
    • /usr/share/doc/php-manual-en/mongogridfs.storeupload.html
    • /usr/share/doc/php-manual-en/mongogridfscursor.construct.html
    • /usr/share/doc/php-manual-en/mongogridfscursor.current.html
    • /usr/share/doc/php-manual-en/mongogridfscursor.getnext.html
    • /usr/share/doc/php-manual-en/mongogridfscursor.key.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.construct.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.getbytes.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.getfilename.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.getresource.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.getsize.html
    • /usr/share/doc/php-manual-en/mongogridfsfile.write.html
    • /usr/share/doc/php-manual-en/mongoid.construct.html
    • /usr/share/doc/php-manual-en/mongoid.gethostname.html
    • /usr/share/doc/php-manual-en/mongoid.getinc.html
    • /usr/share/doc/php-manual-en/mongoid.getpid.html
    • /usr/share/doc/php-manual-en/mongoid.gettimestamp.html
    • /usr/share/doc/php-manual-en/mongoid.set-state.html
    • /usr/share/doc/php-manual-en/mongoid.tostring.html
    • /usr/share/doc/php-manual-en/mongoint32.construct.html
    • /usr/share/doc/php-manual-en/mongoint32.tostring.html
    • /usr/share/doc/php-manual-en/mongoint64.construct.html
    • /usr/share/doc/php-manual-en/mongoint64.tostring.html
    • /usr/share/doc/php-manual-en/mongolog.getcallback.html
    • /usr/share/doc/php-manual-en/mongolog.getlevel.html
    • /usr/share/doc/php-manual-en/mongolog.getmodule.html
    • /usr/share/doc/php-manual-en/mongolog.setcallback.html
    • /usr/share/doc/php-manual-en/mongolog.setlevel.html
    • /usr/share/doc/php-manual-en/mongolog.setmodule.html
    • /usr/share/doc/php-manual-en/mongopool.getsize.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mongopool.setsize.html
    • /usr/share/doc/php-manual-en/mongoregex.construct.html
    • /usr/share/doc/php-manual-en/mongoregex.tostring.html
    • /usr/share/doc/php-manual-en/mongoresultexception.getdocument.html
    • /usr/share/doc/php-manual-en/mongotimestamp.construct.html
    • /usr/share/doc/php-manual-en/mongotimestamp.tostring.html
    • /usr/share/doc/php-manual-en/mpegfile.construct.html
    • /usr/share/doc/php-manual-en/mpegfile.getaudioproperties.html
    • /usr/share/doc/php-manual-en/mpegfile.getid3v1tag.html
    • /usr/share/doc/php-manual-en/mpegfile.getid3v2tag.html
    • /usr/share/doc/php-manual-en/mqseries.configure.html
    • /usr/share/doc/php-manual-en/mqseries.constants.html
    • /usr/share/doc/php-manual-en/mqseries.ini.html
    • /usr/share/doc/php-manual-en/mqseries.requirements.html
    • /usr/share/doc/php-manual-en/mqseries.resources.html
    • /usr/share/doc/php-manual-en/mqseries.setup.html
    • /usr/share/doc/php-manual-en/msession.configuration.html
    • /usr/share/doc/php-manual-en/msession.constants.html
    • /usr/share/doc/php-manual-en/msession.installation.html
    • /usr/share/doc/php-manual-en/msession.requirements.html
    • /usr/share/doc/php-manual-en/msession.resources.html
    • /usr/share/doc/php-manual-en/msession.setup.html
    • /usr/share/doc/php-manual-en/msql.configuration.html
    • /usr/share/doc/php-manual-en/msql.constants.html
    • /usr/share/doc/php-manual-en/msql.examples-basic.html
    • /usr/share/doc/php-manual-en/msql.examples.html
    • /usr/share/doc/php-manual-en/msql.installation.html
    • /usr/share/doc/php-manual-en/msql.requirements.html
    • /usr/share/doc/php-manual-en/msql.resources.html
    • /usr/share/doc/php-manual-en/msql.setup.html
    • /usr/share/doc/php-manual-en/mssql.configuration.html
    • /usr/share/doc/php-manual-en/mssql.constants.html
    • /usr/share/doc/php-manual-en/mssql.installation.html
    • /usr/share/doc/php-manual-en/mssql.requirements.html
    • /usr/share/doc/php-manual-en/mssql.resources.html
    • /usr/share/doc/php-manual-en/mssql.setup.html
    • /usr/share/doc/php-manual-en/multipleiterator.attachiterator.html
    • /usr/share/doc/php-manual-en/multipleiterator.construct.html
    • /usr/share/doc/php-manual-en/multipleiterator.containsiterator.html
    • /usr/share/doc/php-manual-en/multipleiterator.countiterators.html
    • /usr/share/doc/php-manual-en/multipleiterator.current.html
    • /usr/share/doc/php-manual-en/multipleiterator.detachiterator.html
    • /usr/share/doc/php-manual-en/multipleiterator.getflags.html
    • /usr/share/doc/php-manual-en/multipleiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/multipleiterator.rewind.html
    • /usr/share/doc/php-manual-en/multipleiterator.setflags.html
    • /usr/share/doc/php-manual-en/multipleiterator.valid.html
    • /usr/share/doc/php-manual-en/mutex.create.html
    • /usr/share/doc/php-manual-en/mutex.destroy.html
    • /usr/share/doc/php-manual-en/mutex.lock.html
    • /usr/share/doc/php-manual-en/mutex.trylock.html
    • /usr/share/doc/php-manual-en/mutex.unlock.html
    • /usr/share/doc/php-manual-en/mysql.configuration.html
    • /usr/share/doc/php-manual-en/mysql.constants.html
    • /usr/share/doc/php-manual-en/mysql.examples-basic.html
    • /usr/share/doc/php-manual-en/mysql.examples.html
    • /usr/share/doc/php-manual-en/mysql.html
    • /usr/share/doc/php-manual-en/mysql.installation.html
    • /usr/share/doc/php-manual-en/mysql.requirements.html
    • /usr/share/doc/php-manual-en/mysql.resources.html
    • /usr/share/doc/php-manual-en/mysql.setup.html
    • /usr/share/doc/php-manual-en/mysqli-driver.embedded-server-end.html
    • /usr/share/doc/php-manual-en/mysqli-driver.embedded-server-start.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-result.current-field.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-all.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-array.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-assoc.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-field-direct.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-field.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-fields.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-object.html
    • /usr/share/doc/php-manual-en/mysqli-result.fetch-row.html
    • /usr/share/doc/php-manual-en/mysqli-result.field-count.html
    • /usr/share/doc/php-manual-en/mysqli-result.field-seek.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-result.lengths.html
    • /usr/share/doc/php-manual-en/mysqli-result.num-rows.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.affected-rows.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.attr-get.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.attr-set.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.bind-param.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.bind-result.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.close.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-stmt.errno.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.error-list.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.error.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.execute.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.fetch.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.field-count.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-stmt.get-result.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.get-warnings.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.insert-id.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.more-results.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-stmt.num-rows.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.param-count.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.prepare.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.reset.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.result-metadata.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.send-long-data.html
    • /usr/share/doc/php-manual-en/mysqli-stmt.sqlstate.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli-warning.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.affected-rows.html
    • /usr/share/doc/php-manual-en/mysqli.autocommit.html
    • /usr/share/doc/php-manual-en/mysqli.begin-transaction.html
    • /usr/share/doc/php-manual-en/mysqli.change-user.html
    • /usr/share/doc/php-manual-en/mysqli.character-set-name.html
    • /usr/share/doc/php-manual-en/mysqli.client-info.html
    • /usr/share/doc/php-manual-en/mysqli.client-version.html
    • /usr/share/doc/php-manual-en/mysqli.close.html
    • /usr/share/doc/php-manual-en/mysqli.commit.html
    • /usr/share/doc/php-manual-en/mysqli.configuration.html
    • /usr/share/doc/php-manual-en/mysqli.connect-errno.html
    • /usr/share/doc/php-manual-en/mysqli.connect-error.html
    • /usr/share/doc/php-manual-en/mysqli.constants.html
    • /usr/share/doc/php-manual-en/mysqli.construct.html
    • /usr/share/doc/php-manual-en/mysqli.debug.html
    • /usr/share/doc/php-manual-en/mysqli.dump-debug-info.html
    • /usr/share/doc/php-manual-en/mysqli.errno.html
    • /usr/share/doc/php-manual-en/mysqli.error-list.html
    • /usr/share/doc/php-manual-en/mysqli.error.html
    • /usr/share/doc/php-manual-en/mysqli.field-count.html
    • /usr/share/doc/php-manual-en/mysqli.get-charset.html
    • /usr/share/doc/php-manual-en/mysqli.get-client-info.html
    • /usr/share/doc/php-manual-en/mysqli.get-client-stats.html
    • /usr/share/doc/php-manual-en/mysqli.get-client-version.html
    • /usr/share/doc/php-manual-en/mysqli.get-connection-stats.html
    • /usr/share/doc/php-manual-en/mysqli.get-host-info.html
    • /usr/share/doc/php-manual-en/mysqli.get-proto-info.html
    • /usr/share/doc/php-manual-en/mysqli.get-server-info.html
    • /usr/share/doc/php-manual-en/mysqli.get-server-version.html
    • /usr/share/doc/php-manual-en/mysqli.get-warnings.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.init.html
    • /usr/share/doc/php-manual-en/mysqli.insert-id.html
    • /usr/share/doc/php-manual-en/mysqli.installation.html
    • /usr/share/doc/php-manual-en/mysqli.kill.html
    • /usr/share/doc/php-manual-en/mysqli.more-results.html
    • /usr/share/doc/php-manual-en/mysqli.multi-query.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.notes.html
    • /usr/share/doc/php-manual-en/mysqli.options.html
    • /usr/share/doc/php-manual-en/mysqli.overview.html
    • /usr/share/doc/php-manual-en/mysqli.persistconns.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.poll.html
    • /usr/share/doc/php-manual-en/mysqli.prepare.html
    • /usr/share/doc/php-manual-en/mysqli.query.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.connections.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.dual-interface.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.metadata.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.multiple-statement.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.prepared-statements.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.statements.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.stored-procedures.html
    • /usr/share/doc/php-manual-en/mysqli.quickstart.transactions.html
    • /usr/share/doc/php-manual-en/mysqli.real-connect.html
    • /usr/share/doc/php-manual-en/mysqli.real-escape-string.html
    • /usr/share/doc/php-manual-en/mysqli.real-query.html
    • /usr/share/doc/php-manual-en/mysqli.reap-async-query.html
    • /usr/share/doc/php-manual-en/mysqli.refresh.html
    • /usr/share/doc/php-manual-en/mysqli.release-savepoint.html
    • /usr/share/doc/php-manual-en/mysqli.requirements.html
    • /usr/share/doc/php-manual-en/mysqli.resources.html
    • /usr/share/doc/php-manual-en/mysqli.rollback.html
    • /usr/share/doc/php-manual-en/mysqli.rpl-query-type.html
    • /usr/share/doc/php-manual-en/mysqli.savepoint.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.send-query.html
    • /usr/share/doc/php-manual-en/mysqli.set-charset.html
    • /usr/share/doc/php-manual-en/mysqli.set-local-infile-default.html
    • /usr/share/doc/php-manual-en/mysqli.set-local-infile-handler.html
    • /usr/share/doc/php-manual-en/mysqli.setup.html
    • /usr/share/doc/php-manual-en/mysqli.sqlstate.html
    • /usr/share/doc/php-manual-en/mysqli.ssl-set.html
    • /usr/share/doc/php-manual-en/mysqli.stat.html
    • /usr/share/doc/php-manual-en/mysqli.stmt-init.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqli.summary.html
    • /usr/share/doc/php-manual-en/mysqli.thread-id.html
    • /usr/share/doc/php-manual-en/mysqli.thread-safe.html
    • /usr/share/doc/php-manual-en/mysqli.use-result.html
    • /usr/share/doc/php-manual-en/mysqli.warning-count.html
    • /usr/share/doc/php-manual-en/mysqlinfo.api.choosing.html
    • /usr/share/doc/php-manual-en/mysqlinfo.concepts.buffering.html
    • /usr/share/doc/php-manual-en/mysqlinfo.concepts.charset.html
    • /usr/share/doc/php-manual-en/mysqlinfo.concepts.html
    • /usr/share/doc/php-manual-en/mysqlinfo.library.choosing.html
    • /usr/share/doc/php-manual-en/mysqlinfo.terminology.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.changes-one-o.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.changes.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.constants.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.quickstart.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.quickstart.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.quickstart.usage.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.requirements.html
    • /usr/share/doc/php-manual-en/mysqlnd-memcache.setup.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.architecture.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-five.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-four.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-o.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-one.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-six.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-three.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes-one-two.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.changes.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.concept_cache.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.concepts.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.constants.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.debugging.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.errorhandling.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.failover.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.filter.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.gtid.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.loadbalancing.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.monitoring.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.plugin-ini-json.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.plugin-ini-v1.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.pooling.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.qos-consistency.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.cache.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.connectionpooling.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.failover.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.gtid.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.partitioning.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.qos-consistency.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.sqlhints.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.transactions.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.quickstart.usage.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.requirements.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.rwsplit.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.setup.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.supportedclusters.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.testing.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.transaction.html
    • /usr/share/doc/php-manual-en/mysqlnd-ms.transient_errors.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.architecture.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.changes-one-o.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.changes.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.concepts.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.connection_pool.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.constants.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.requirements.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.setup.html
    • /usr/share/doc/php-manual-en/mysqlnd-mux.sharing_connections.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.cache-candidates.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.cache-efficiency.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.changes-one-o.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.changes-one-one.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.changes-one-two.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.changes.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.constants.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.pattern-based-caching.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.per-query-ttl.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.quickstart.caching.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.quickstart.concepts.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.quickstart.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.quickstart.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.requirements.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.set-user-handlers.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.setup.html
    • /usr/share/doc/php-manual-en/mysqlnd-qc.slam-defense.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.changes-one-o.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.changes.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.configuration.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.constants.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.quickstart.configuration.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqlnd-uh.quickstart.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.quickstart.proxy-installation.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.quickstart.query-monitoring.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.requirements.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.resources.html
    • /usr/share/doc/php-manual-en/mysqlnd-uh.setup.html
    • /usr/share/doc/php-manual-en/mysqlnd.config.html
    • /usr/share/doc/php-manual-en/mysqlnd.incompatibilities.html
    • /usr/share/doc/php-manual-en/mysqlnd.install.html
    • /usr/share/doc/php-manual-en/mysqlnd.notes.html
    • /usr/share/doc/php-manual-en/mysqlnd.overview.html
    • /usr/share/doc/php-manual-en/mysqlnd.persist.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.api.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.architecture.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.developing.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.mysql-proxy.html
    • /usr/share/doc/php-manual-en/mysqlnd.plugin.obtaining.html
    • /usr/share/doc/php-manual-en/mysqlnd.stats.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.changeuser.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.charsetname.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.close.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.connect.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.construct.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.endpsession.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.escapestring.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getaffectedrows.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.geterrornumber.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.geterrorstring.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getfieldcount.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.gethostinformation.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getlastinsertid.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getlastmessage.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getprotocolinformation.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getserverinformation.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getserverstatistics.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getserverversion.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getsqlstate.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getstatistics.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getthreadid.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.getwarningcount.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.init.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.killconnection.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.listfields.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.listmethod.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.moreresults.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.nextresult.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.query.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.queryreadresultsetheader.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.reapquery.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.refreshserver.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.restartpsession.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.selectdb.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.sendclose.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.sendquery.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.serverdumpdebuginformation.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.setautocommit.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.setcharset.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.setclientoption.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.setserveroption.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.shutdownserver.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.simplecommand.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.simplecommandhandleresponse.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.sslset.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.stmtinit.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.storeresult.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.txcommit.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.txrollback.html
    • /usr/share/doc/php-manual-en/mysqlnduhconnection.useresult.html
    • /usr/share/doc/php-manual-en/mysqlnduhpreparedstatement.construct.html
    • /usr/share/doc/php-manual-en/mysqlnduhpreparedstatement.execute.html
    • /usr/share/doc/php-manual-en/mysqlnduhpreparedstatement.prepare.html
    • /usr/share/doc/php-manual-en/ncurses.colorconsts.html
    • /usr/share/doc/php-manual-en/ncurses.configuration.html
    • /usr/share/doc/php-manual-en/ncurses.constants.html
    • /usr/share/doc/php-manual-en/ncurses.errconsts.html
    • /usr/share/doc/php-manual-en/ncurses.installation.html
    • /usr/share/doc/php-manual-en/ncurses.keyconsts.html
    • /usr/share/doc/php-manual-en/ncurses.mouseconsts.html
    • /usr/share/doc/php-manual-en/ncurses.requirements.html
    • /usr/share/doc/php-manual-en/ncurses.resources.html
    • /usr/share/doc/php-manual-en/ncurses.setup.html
    • /usr/share/doc/php-manual-en/net-gopher.configuration.html
    • /usr/share/doc/php-manual-en/net-gopher.constants.html
    • /usr/share/doc/php-manual-en/net-gopher.examples-basic.html
    • /usr/share/doc/php-manual-en/net-gopher.examples.html
    • /usr/share/doc/php-manual-en/net-gopher.install.html
    • /usr/share/doc/php-manual-en/net-gopher.requirements.html
    • /usr/share/doc/php-manual-en/net-gopher.resources.html
    • /usr/share/doc/php-manual-en/net-gopher.setup.html
    • /usr/share/doc/php-manual-en/network.configuration.html
    • /usr/share/doc/php-manual-en/network.constants.html
    • /usr/share/doc/php-manual-en/network.installation.html
    • /usr/share/doc/php-manual-en/network.requirements.html
    • /usr/share/doc/php-manual-en/network.resources.html
    • /usr/share/doc/php-manual-en/network.setup.html
    • /usr/share/doc/php-manual-en/newt.configuration.html
    • /usr/share/doc/php-manual-en/newt.constants.html
    • /usr/share/doc/php-manual-en/newt.examples-usage.html
    • /usr/share/doc/php-manual-en/newt.examples.html
    • /usr/share/doc/php-manual-en/newt.installation.html
    • /usr/share/doc/php-manual-en/newt.requirements.html
    • /usr/share/doc/php-manual-en/newt.resources.html
    • /usr/share/doc/php-manual-en/newt.setup.html
    • /usr/share/doc/php-manual-en/nis.configuration.html
    • /usr/share/doc/php-manual-en/nis.constants.html
    • /usr/share/doc/php-manual-en/nis.installation.html
    • /usr/share/doc/php-manual-en/nis.requirements.html
    • /usr/share/doc/php-manual-en/nis.resources.html
    • /usr/share/doc/php-manual-en/nis.setup.html
    • /usr/share/doc/php-manual-en/norewinditerator.construct.html
    • /usr/share/doc/php-manual-en/norewinditerator.current.html
    • /usr/share/doc/php-manual-en/norewinditerator.getinneriterator.html
    • /usr/share/doc/php-manual-en/norewinditerator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/norewinditerator.rewind.html
    • /usr/share/doc/php-manual-en/norewinditerator.valid.html
    • /usr/share/doc/php-manual-en/normalizer.isnormalized.html
    • /usr/share/doc/php-manual-en/normalizer.normalize.html
    • /usr/share/doc/php-manual-en/notes.configuration.html
    • /usr/share/doc/php-manual-en/notes.constants.html
    • /usr/share/doc/php-manual-en/notes.installation.html
    • /usr/share/doc/php-manual-en/notes.requirements.html
    • /usr/share/doc/php-manual-en/notes.resources.html
    • /usr/share/doc/php-manual-en/notes.setup.html
    • /usr/share/doc/php-manual-en/nsapi.configuration.html
    • /usr/share/doc/php-manual-en/nsapi.constants.html
    • /usr/share/doc/php-manual-en/nsapi.installation.html
    • /usr/share/doc/php-manual-en/nsapi.requirements.html
    • /usr/share/doc/php-manual-en/nsapi.resources.html
    • /usr/share/doc/php-manual-en/nsapi.setup.html
    • /usr/share/doc/php-manual-en/numberformatter.create.html
    • /usr/share/doc/php-manual-en/numberformatter.format.html
    • /usr/share/doc/php-manual-en/numberformatter.formatcurrency.html
    • /usr/share/doc/php-manual-en/numberformatter.getattribute.html
    • /usr/share/doc/php-manual-en/numberformatter.geterrorcode.html
    • /usr/share/doc/php-manual-en/numberformatter.geterrormessage.html
    • /usr/share/doc/php-manual-en/numberformatter.getlocale.html
    • /usr/share/doc/php-manual-en/numberformatter.getpattern.html
    • /usr/share/doc/php-manual-en/numberformatter.getsymbol.html
    • /usr/share/doc/php-manual-en/numberformatter.gettextattribute.html
    • /usr/share/doc/php-manual-en/numberformatter.parse.html
    • /usr/share/doc/php-manual-en/numberformatter.parsecurrency.html
    • /usr/share/doc/php-manual-en/numberformatter.setattribute.html
    • /usr/share/doc/php-manual-en/numberformatter.setpattern.html
    • /usr/share/doc/php-manual-en/numberformatter.setsymbol.html
    • /usr/share/doc/php-manual-en/numberformatter.settextattribute.html
    • /usr/share/doc/php-manual-en/oauth.configuration.html
    • /usr/share/doc/php-manual-en/oauth.constants.html
    • /usr/share/doc/php-manual-en/oauth.construct.html
    • /usr/share/doc/php-manual-en/oauth.destruct.html
    • /usr/share/doc/php-manual-en/oauth.disabledebug.html
    • /usr/share/doc/php-manual-en/oauth.disableredirects.html
    • /usr/share/doc/php-manual-en/oauth.disablesslchecks.html
    • /usr/share/doc/php-manual-en/oauth.enabledebug.html
    • /usr/share/doc/php-manual-en/oauth.enableredirects.html
    • /usr/share/doc/php-manual-en/oauth.enablesslchecks.html
    • /usr/share/doc/php-manual-en/oauth.examples.fireeagle.html
    • /usr/share/doc/php-manual-en/oauth.examples.html
    • /usr/share/doc/php-manual-en/oauth.fetch.html
    • /usr/share/doc/php-manual-en/oauth.generatesignature.html
    • /usr/share/doc/php-manual-en/oauth.getaccesstoken.html
    • /usr/share/doc/php-manual-en/oauth.getcapath.html
    • /usr/share/doc/php-manual-en/oauth.getlastresponse.html
    • /usr/share/doc/php-manual-en/oauth.getlastresponseheaders.html
    • /usr/share/doc/php-manual-en/oauth.getlastresponseinfo.html
    • /usr/share/doc/php-manual-en/oauth.getrequestheader.html
    • /usr/share/doc/php-manual-en/oauth.getrequesttoken.html
    • /usr/share/doc/php-manual-en/oauth.installation.html
    • /usr/share/doc/php-manual-en/oauth.requirements.html
    • /usr/share/doc/php-manual-en/oauth.resources.html
    • /usr/share/doc/php-manual-en/oauth.setauthtype.html
    • /usr/share/doc/php-manual-en/oauth.setcapath.html
    • /usr/share/doc/php-manual-en/oauth.setnonce.html
    • /usr/share/doc/php-manual-en/oauth.setrequestengine.html
    • /usr/share/doc/php-manual-en/oauth.setrsacertificate.html
    • /usr/share/doc/php-manual-en/oauth.setsslchecks.html
    • /usr/share/doc/php-manual-en/oauth.settimestamp.html
    • /usr/share/doc/php-manual-en/oauth.settoken.html
    • /usr/share/doc/php-manual-en/oauth.setup.html
    • /usr/share/doc/php-manual-en/oauth.setversion.html
    • /usr/share/doc/php-manual-en/oauthprovider.addrequiredparameter.html
    • /usr/share/doc/php-manual-en/oauthprovider.callconsumerhandler.html
    • /usr/share/doc/php-manual-en/oauthprovider.calltimestampnoncehandler.html
    • /usr/share/doc/php-manual-en/oauthprovider.calltokenhandler.html
    • /usr/share/doc/php-manual-en/oauthprovider.checkoauthrequest.html
    • /usr/share/doc/php-manual-en/oauthprovider.construct.html
    • /usr/share/doc/php-manual-en/oauthprovider.consumerhandler.html
    • /usr/share/doc/php-manual-en/oauthprovider.generatetoken.html
    • /usr/share/doc/php-manual-en/oauthprovider.is2leggedendpoint.html
    • /usr/share/doc/php-manual-en/oauthprovider.isrequesttokenendpoint.html
    • /usr/share/doc/php-manual-en/oauthprovider.removerequiredparameter.html
    • /usr/share/doc/php-manual-en/oauthprovider.reportproblem.html
    • /usr/share/doc/php-manual-en/oauthprovider.setparam.html
    • /usr/share/doc/php-manual-en/oauthprovider.setrequesttokenpath.html
    • /usr/share/doc/php-manual-en/oauthprovider.timestampnoncehandler.html
    • /usr/share/doc/php-manual-en/oauthprovider.tokenhandler.html
    • /usr/share/doc/php-manual-en/objaggregation.examples.association.html
    • /usr/share/doc/php-manual-en/objaggregation.examples.html
    • /usr/share/doc/php-manual-en/objaggregation.examples2.html
    • /usr/share/doc/php-manual-en/oci-collection.append.html
    • /usr/share/doc/php-manual-en/oci-collection.assign.html
    • /usr/share/doc/php-manual-en/oci-collection.assignelem.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci-collection.getelem.html
    • /usr/share/doc/php-manual-en/oci-collection.max.html
    • /usr/share/doc/php-manual-en/oci-collection.size.html
    • /usr/share/doc/php-manual-en/oci-collection.trim.html
    • /usr/share/doc/php-manual-en/oci-lob.append.html
    • /usr/share/doc/php-manual-en/oci-lob.close.html
    • /usr/share/doc/php-manual-en/oci-lob.eof.html
    • /usr/share/doc/php-manual-en/oci-lob.erase.html
    • /usr/share/doc/php-manual-en/oci-lob.export.html
    • /usr/share/doc/php-manual-en/oci-lob.flush.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci-lob.getbuffering.html
    • /usr/share/doc/php-manual-en/oci-lob.import.html
    • /usr/share/doc/php-manual-en/oci-lob.load.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci-lob.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci-lob.savefile.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci-lob.setbuffering.html
    • /usr/share/doc/php-manual-en/oci-lob.size.html
    • /usr/share/doc/php-manual-en/oci-lob.tell.html
    • /usr/share/doc/php-manual-en/oci-lob.truncate.html
    • /usr/share/doc/php-manual-en/oci-lob.write.html
    • /usr/share/doc/php-manual-en/oci-lob.writetemporary.html
    • /usr/share/doc/php-manual-en/oci-lob.writetofile.html
    • /usr/share/doc/php-manual-en/oci8.configuration.html
    • /usr/share/doc/php-manual-en/oci8.connection.html
    • /usr/share/doc/php-manual-en/oci8.constants.html
    • /usr/share/doc/php-manual-en/oci8.datatypes.html
    • /usr/share/doc/php-manual-en/oci8.dtrace.html
    • /usr/share/doc/php-manual-en/oci8.examples.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/oci8.installation.html
    • /usr/share/doc/php-manual-en/oci8.requirements.html
    • /usr/share/doc/php-manual-en/oci8.setup.html
    • /usr/share/doc/php-manual-en/oci8.test.html
    • /usr/share/doc/php-manual-en/odbc.configuration.html
    • /usr/share/doc/php-manual-en/odbc.installation.html
    • /usr/share/doc/php-manual-en/oggvorbis.configuration.html
    • /usr/share/doc/php-manual-en/oggvorbis.constants.html
    • /usr/share/doc/php-manual-en/oggvorbis.contexts.html
    • /usr/share/doc/php-manual-en/oggvorbis.examples-basisc.html
    • /usr/share/doc/php-manual-en/oggvorbis.examples.html
    • /usr/share/doc/php-manual-en/oggvorbis.installation.html
    • /usr/share/doc/php-manual-en/oggvorbis.requirements.html
    • /usr/share/doc/php-manual-en/oggvorbis.resources.html
    • /usr/share/doc/php-manual-en/oggvorbis.setup.html
    • /usr/share/doc/php-manual-en/oldaliases.cubrid.html
    • /usr/share/doc/php-manual-en/oldaliases.oci8.html
    • /usr/share/doc/php-manual-en/oop4.constructor.html
    • /usr/share/doc/php-manual-en/oop4.html
    • /usr/share/doc/php-manual-en/oop4.magic-functions.html
    • /usr/share/doc/php-manual-en/oop4.newref.html
    • /usr/share/doc/php-manual-en/oop4.object-comparison.html
    • /usr/share/doc/php-manual-en/oop4.serialization.html
    • /usr/share/doc/php-manual-en/oop5.intro.html
    • /usr/share/doc/php-manual-en/opcache.configuration.html
    • /usr/share/doc/php-manual-en/opcache.installation.html
    • /usr/share/doc/php-manual-en/opcache.requirements.html
    • /usr/share/doc/php-manual-en/opcache.resources.html
    • /usr/share/doc/php-manual-en/opcache.setup.html
    • /usr/share/doc/php-manual-en/openal.configuration.html
    • /usr/share/doc/php-manual-en/openal.constants.html
    • /usr/share/doc/php-manual-en/openal.installation.html
    • /usr/share/doc/php-manual-en/openal.requirements.html
    • /usr/share/doc/php-manual-en/openal.resources.html
    • /usr/share/doc/php-manual-en/openal.setup.html
    • /usr/share/doc/php-manual-en/openssl.cert.verification.html
    • /usr/share/doc/php-manual-en/openssl.certparams.html
    • /usr/share/doc/php-manual-en/openssl.ciphers.html
    • /usr/share/doc/php-manual-en/openssl.configuration.html
    • /usr/share/doc/php-manual-en/openssl.constants.html
    • /usr/share/doc/php-manual-en/openssl.constsni.html
    • /usr/share/doc/php-manual-en/openssl.constversion.html
    • /usr/share/doc/php-manual-en/openssl.installation.html
    • /usr/share/doc/php-manual-en/openssl.key-types.html
    • /usr/share/doc/php-manual-en/openssl.padding.html
    • /usr/share/doc/php-manual-en/openssl.pkcs7.flags.html
    • /usr/share/doc/php-manual-en/openssl.purpose-check.html
    • /usr/share/doc/php-manual-en/openssl.requirements.html
    • /usr/share/doc/php-manual-en/openssl.resources.html
    • /usr/share/doc/php-manual-en/openssl.setup.html
    • /usr/share/doc/php-manual-en/openssl.signature-algos.html
    • /usr/share/doc/php-manual-en/outcontrol.configuration.html
    • /usr/share/doc/php-manual-en/outcontrol.constants.html
    • /usr/share/doc/php-manual-en/outcontrol.examples.basic.html
    • /usr/share/doc/php-manual-en/outcontrol.examples.html
    • /usr/share/doc/php-manual-en/outcontrol.installation.html
    • /usr/share/doc/php-manual-en/outcontrol.requirements.html
    • /usr/share/doc/php-manual-en/outcontrol.resources.html
    • /usr/share/doc/php-manual-en/outcontrol.setup.html
    • /usr/share/doc/php-manual-en/outeriterator.getinneriterator.html
    • /usr/share/doc/php-manual-en/ovrimos.configuration.html
    • /usr/share/doc/php-manual-en/ovrimos.constants.html
    • /usr/share/doc/php-manual-en/ovrimos.examples-basic.html
    • /usr/share/doc/php-manual-en/ovrimos.examples.html
    • /usr/share/doc/php-manual-en/ovrimos.installation.html
    • /usr/share/doc/php-manual-en/ovrimos.requirements.html
    • /usr/share/doc/php-manual-en/ovrimos.resources.html
    • /usr/share/doc/php-manual-en/ovrimos.setup.html
    • /usr/share/doc/php-manual-en/paradox.configuration.html
    • /usr/share/doc/php-manual-en/paradox.constants.html
    • /usr/share/doc/php-manual-en/paradox.installation.html
    • /usr/share/doc/php-manual-en/paradox.requirements.html
    • /usr/share/doc/php-manual-en/paradox.resources.html
    • /usr/share/doc/php-manual-en/paradox.setup.html
    • /usr/share/doc/php-manual-en/parentiterator.accept.html
    • /usr/share/doc/php-manual-en/parentiterator.construct.html
    • /usr/share/doc/php-manual-en/parentiterator.getchildren.html
    • /usr/share/doc/php-manual-en/parentiterator.haschildren.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/parentiterator.rewind.html
    • /usr/share/doc/php-manual-en/parsekit.configuration.html
    • /usr/share/doc/php-manual-en/parsekit.constants.html
    • /usr/share/doc/php-manual-en/parsekit.installation.html
    • /usr/share/doc/php-manual-en/parsekit.requirements.html
    • /usr/share/doc/php-manual-en/parsekit.resources.html
    • /usr/share/doc/php-manual-en/parsekit.setup.html
    • /usr/share/doc/php-manual-en/password.configuration.html
    • /usr/share/doc/php-manual-en/password.constants.html
    • /usr/share/doc/php-manual-en/password.installation.html
    • /usr/share/doc/php-manual-en/password.requirements.html
    • /usr/share/doc/php-manual-en/password.resources.html
    • /usr/share/doc/php-manual-en/password.setup.html
    • /usr/share/doc/php-manual-en/pcntl.configuration.html
    • /usr/share/doc/php-manual-en/pcntl.constants.html
    • /usr/share/doc/php-manual-en/pcntl.example.html
    • /usr/share/doc/php-manual-en/pcntl.examples.html
    • /usr/share/doc/php-manual-en/pcntl.installation.html
    • /usr/share/doc/php-manual-en/pcntl.requirements.html
    • /usr/share/doc/php-manual-en/pcntl.resources.html
    • /usr/share/doc/php-manual-en/pcntl.setup.html
    • /usr/share/doc/php-manual-en/pcre.configuration.html
    • /usr/share/doc/php-manual-en/pcre.constants.html
    • /usr/share/doc/php-manual-en/pcre.examples.html
    • /usr/share/doc/php-manual-en/pcre.installation.html
    • /usr/share/doc/php-manual-en/pcre.pattern.html
    • /usr/share/doc/php-manual-en/pcre.requirements.html
    • /usr/share/doc/php-manual-en/pcre.resources.html
    • /usr/share/doc/php-manual-en/pcre.setup.html
    • /usr/share/doc/php-manual-en/pdf.configuration.html
    • /usr/share/doc/php-manual-en/pdf.constants.html
    • /usr/share/doc/php-manual-en/pdf.examples-basic.html
    • /usr/share/doc/php-manual-en/pdf.examples.html
    • /usr/share/doc/php-manual-en/pdf.installation.html
    • /usr/share/doc/php-manual-en/pdf.requirements.html
    • /usr/share/doc/php-manual-en/pdf.resources.html
    • /usr/share/doc/php-manual-en/pdf.setup.html
    • /usr/share/doc/php-manual-en/pdo-4d.constants.html
    • /usr/share/doc/php-manual-en/pdo-4d.examples.html
    • /usr/share/doc/php-manual-en/pdo-4d.sqltypes.html
    • /usr/share/doc/php-manual-en/pdo.begintransaction.html
    • /usr/share/doc/php-manual-en/pdo.commit.html
    • /usr/share/doc/php-manual-en/pdo.configuration.html
    • /usr/share/doc/php-manual-en/pdo.connections.html
    • /usr/share/doc/php-manual-en/pdo.constants.html
    • /usr/share/doc/php-manual-en/pdo.construct.html
    • /usr/share/doc/php-manual-en/pdo.cubrid-schema.html
    • /usr/share/doc/php-manual-en/pdo.drivers.html
    • /usr/share/doc/php-manual-en/pdo.error-handling.html
    • /usr/share/doc/php-manual-en/pdo.errorcode.html
    • /usr/share/doc/php-manual-en/pdo.errorinfo.html
    • /usr/share/doc/php-manual-en/pdo.exec.html
    • /usr/share/doc/php-manual-en/pdo.getattribute.html
    • /usr/share/doc/php-manual-en/pdo.getavailabledrivers.html
    • /usr/share/doc/php-manual-en/pdo.installation.html
    • /usr/share/doc/php-manual-en/pdo.intransaction.html
    • /usr/share/doc/php-manual-en/pdo.lastinsertid.html
    • /usr/share/doc/php-manual-en/pdo.lobs.html
    • /usr/share/doc/php-manual-en/pdo.pgsqllobcreate.html
    • /usr/share/doc/php-manual-en/pdo.pgsqllobopen.html
    • /usr/share/doc/php-manual-en/pdo.pgsqllobunlink.html
    • /usr/share/doc/php-manual-en/pdo.prepare.html
    • /usr/share/doc/php-manual-en/pdo.prepared-statements.html
    • /usr/share/doc/php-manual-en/pdo.query.html
    • /usr/share/doc/php-manual-en/pdo.quote.html
    • /usr/share/doc/php-manual-en/pdo.requirements.html
    • /usr/share/doc/php-manual-en/pdo.resources.html
    • /usr/share/doc/php-manual-en/pdo.rollback.html
    • /usr/share/doc/php-manual-en/pdo.setattribute.html
    • /usr/share/doc/php-manual-en/pdo.setup.html
    • /usr/share/doc/php-manual-en/pdo.sqlitecreateaggregate.html
    • /usr/share/doc/php-manual-en/pdo.sqlitecreatefunction.html
    • /usr/share/doc/php-manual-en/pdo.transactions.html
    • /usr/share/doc/php-manual-en/pdostatement.bindcolumn.html
    • /usr/share/doc/php-manual-en/pdostatement.bindparam.html
    • /usr/share/doc/php-manual-en/pdostatement.bindvalue.html
    • /usr/share/doc/php-manual-en/pdostatement.closecursor.html
    • /usr/share/doc/php-manual-en/pdostatement.columncount.html
    • /usr/share/doc/php-manual-en/pdostatement.debugdumpparams.html
    • /usr/share/doc/php-manual-en/pdostatement.errorcode.html
    • /usr/share/doc/php-manual-en/pdostatement.errorinfo.html
    • /usr/share/doc/php-manual-en/pdostatement.execute.html
    • /usr/share/doc/php-manual-en/pdostatement.fetch.html
    • /usr/share/doc/php-manual-en/pdostatement.fetchall.html
    • /usr/share/doc/php-manual-en/pdostatement.fetchcolumn.html
    • /usr/share/doc/php-manual-en/pdostatement.fetchobject.html
    • /usr/share/doc/php-manual-en/pdostatement.getattribute.html
    • /usr/share/doc/php-manual-en/pdostatement.getcolumnmeta.html
    • /usr/share/doc/php-manual-en/pdostatement.nextrowset.html
    • /usr/share/doc/php-manual-en/pdostatement.rowcount.html
    • /usr/share/doc/php-manual-en/pdostatement.setattribute.html
    • /usr/share/doc/php-manual-en/pdostatement.setfetchmode.html
    • /usr/share/doc/php-manual-en/pecl.kadm5.constantsop.html
    • /usr/share/doc/php-manual-en/pgsql.configuration.html
    • /usr/share/doc/php-manual-en/pgsql.constants.html
    • /usr/share/doc/php-manual-en/pgsql.examples-basic.html
    • /usr/share/doc/php-manual-en/pgsql.examples.html
    • /usr/share/doc/php-manual-en/pgsql.installation.html
    • /usr/share/doc/php-manual-en/pgsql.requirements.html
    • /usr/share/doc/php-manual-en/pgsql.resources.html
    • /usr/share/doc/php-manual-en/pgsql.setup.html
    • /usr/share/doc/php-manual-en/phar.addemptydir.html
    • /usr/share/doc/php-manual-en/phar.addfile.html
    • /usr/share/doc/php-manual-en/phar.addfromstring.html
    • /usr/share/doc/php-manual-en/phar.apiversion.html
    • /usr/share/doc/php-manual-en/phar.buildfromdirectory.html
    • /usr/share/doc/php-manual-en/phar.buildfromiterator.html
    • /usr/share/doc/php-manual-en/phar.cancompress.html
    • /usr/share/doc/php-manual-en/phar.canwrite.html
    • /usr/share/doc/php-manual-en/phar.compress.html
    • /usr/share/doc/php-manual-en/phar.compressallfilesbzip2.html
    • /usr/share/doc/php-manual-en/phar.compressallfilesgz.html
    • /usr/share/doc/php-manual-en/phar.compressfiles.html
    • /usr/share/doc/php-manual-en/phar.configuration.html
    • /usr/share/doc/php-manual-en/phar.constants.html
    • /usr/share/doc/php-manual-en/phar.construct.html
    • /usr/share/doc/php-manual-en/phar.converttodata.html
    • /usr/share/doc/php-manual-en/phar.converttoexecutable.html
    • /usr/share/doc/php-manual-en/phar.copy.html
    • /usr/share/doc/php-manual-en/phar.count.html
    • /usr/share/doc/php-manual-en/phar.createdefaultstub.html
    • /usr/share/doc/php-manual-en/phar.creating.html
    • /usr/share/doc/php-manual-en/phar.creating.intro.html
    • /usr/share/doc/php-manual-en/phar.decompress.html
    • /usr/share/doc/php-manual-en/phar.decompressfiles.html
    • /usr/share/doc/php-manual-en/phar.delete.html
    • /usr/share/doc/php-manual-en/phar.delmetadata.html
    • /usr/share/doc/php-manual-en/phar.extractto.html
    • /usr/share/doc/php-manual-en/phar.fileformat.comparison.html
    • /usr/share/doc/php-manual-en/phar.fileformat.flags.html
    • /usr/share/doc/php-manual-en/phar.fileformat.html
    • /usr/share/doc/php-manual-en/phar.fileformat.ingredients.html
    • /usr/share/doc/php-manual-en/phar.fileformat.manifestfile.html
    • /usr/share/doc/php-manual-en/phar.fileformat.phar.html
    • /usr/share/doc/php-manual-en/phar.fileformat.signature.html
    • /usr/share/doc/php-manual-en/phar.fileformat.stub.html
    • /usr/share/doc/php-manual-en/phar.fileformat.tar.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/phar.getmetadata.html
    • /usr/share/doc/php-manual-en/phar.getmodified.html
    • /usr/share/doc/php-manual-en/phar.getsignature.html
    • /usr/share/doc/php-manual-en/phar.getstub.html
    • /usr/share/doc/php-manual-en/phar.getsupportedcompression.html
    • /usr/share/doc/php-manual-en/phar.getsupportedsignatures.html
    • /usr/share/doc/php-manual-en/phar.getversion.html
    • /usr/share/doc/php-manual-en/phar.hasmetadata.html
    • /usr/share/doc/php-manual-en/phar.installation.html
    • /usr/share/doc/php-manual-en/phar.interceptfilefuncs.html
    • /usr/share/doc/php-manual-en/phar.isbuffering.html
    • /usr/share/doc/php-manual-en/phar.iscompressed.html
    • /usr/share/doc/php-manual-en/phar.isfileformat.html
    • /usr/share/doc/php-manual-en/phar.isvalidpharfilename.html
    • /usr/share/doc/php-manual-en/phar.iswritable.html
    • /usr/share/doc/php-manual-en/phar.loadphar.html
    • /usr/share/doc/php-manual-en/phar.mapphar.html
    • /usr/share/doc/php-manual-en/phar.mount.html
    • /usr/share/doc/php-manual-en/phar.mungserver.html
    • /usr/share/doc/php-manual-en/phar.offsetexists.html
    • /usr/share/doc/php-manual-en/phar.offsetget.html
    • /usr/share/doc/php-manual-en/phar.offsetset.html
    • /usr/share/doc/php-manual-en/phar.offsetunset.html
    • /usr/share/doc/php-manual-en/phar.requirements.html
    • /usr/share/doc/php-manual-en/phar.resources.html
    • /usr/share/doc/php-manual-en/phar.running.html
    • /usr/share/doc/php-manual-en/phar.setalias.html
    • /usr/share/doc/php-manual-en/phar.setdefaultstub.html
    • /usr/share/doc/php-manual-en/phar.setmetadata.html
    • /usr/share/doc/php-manual-en/phar.setsignaturealgorithm.html
    • /usr/share/doc/php-manual-en/phar.setstub.html
    • /usr/share/doc/php-manual-en/phar.setup.html
    • /usr/share/doc/php-manual-en/phar.startbuffering.html
    • /usr/share/doc/php-manual-en/phar.stopbuffering.html
    • /usr/share/doc/php-manual-en/phar.uncompressallfiles.html
    • /usr/share/doc/php-manual-en/phar.unlinkarchive.html
    • /usr/share/doc/php-manual-en/phar.using.html
    • /usr/share/doc/php-manual-en/phar.using.intro.html
    • /usr/share/doc/php-manual-en/phar.using.object.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/phar.webphar.html
    • /usr/share/doc/php-manual-en/phardata.addemptydir.html
    • /usr/share/doc/php-manual-en/phardata.addfile.html
    • /usr/share/doc/php-manual-en/phardata.addfromstring.html
    • /usr/share/doc/php-manual-en/phardata.buildfromdirectory.html
    • /usr/share/doc/php-manual-en/phardata.buildfromiterator.html
    • /usr/share/doc/php-manual-en/phardata.compress.html
    • /usr/share/doc/php-manual-en/phardata.compressfiles.html
    • /usr/share/doc/php-manual-en/phardata.construct.html
    • /usr/share/doc/php-manual-en/phardata.converttodata.html
    • /usr/share/doc/php-manual-en/phardata.converttoexecutable.html
    • /usr/share/doc/php-manual-en/phardata.copy.html
    • /usr/share/doc/php-manual-en/phardata.decompress.html
    • /usr/share/doc/php-manual-en/phardata.decompressfiles.html
    • /usr/share/doc/php-manual-en/phardata.delete.html
    • /usr/share/doc/php-manual-en/phardata.delmetadata.html
    • /usr/share/doc/php-manual-en/phardata.extractto.html
    • /usr/share/doc/php-manual-en/phardata.iswritable.html
    • /usr/share/doc/php-manual-en/phardata.offsetset.html
    • /usr/share/doc/php-manual-en/phardata.offsetunset.html
    • /usr/share/doc/php-manual-en/phardata.setalias.html
    • /usr/share/doc/php-manual-en/phardata.setdefaultstub.html
    • /usr/share/doc/php-manual-en/phardata.setmetadata.html
    • /usr/share/doc/php-manual-en/phardata.setsignaturealgorithm.html
    • /usr/share/doc/php-manual-en/phardata.setstub.html
    • /usr/share/doc/php-manual-en/pharexception.intro.unused.html
    • /usr/share/doc/php-manual-en/pharfileinfo.chmod.html
    • /usr/share/doc/php-manual-en/pharfileinfo.compress.html
    • /usr/share/doc/php-manual-en/pharfileinfo.construct.html
    • /usr/share/doc/php-manual-en/pharfileinfo.decompress.html
    • /usr/share/doc/php-manual-en/pharfileinfo.delmetadata.html
    • /usr/share/doc/php-manual-en/pharfileinfo.getcompressedsize.html
    • /usr/share/doc/php-manual-en/pharfileinfo.getcrc32.html
    • /usr/share/doc/php-manual-en/pharfileinfo.getmetadata.html
    • /usr/share/doc/php-manual-en/pharfileinfo.getpharflags.html
    • /usr/share/doc/php-manual-en/pharfileinfo.hasmetadata.html
    • /usr/share/doc/php-manual-en/pharfileinfo.iscompressed.html
    • /usr/share/doc/php-manual-en/pharfileinfo.iscompressedbzip2.html
    • /usr/share/doc/php-manual-en/pharfileinfo.iscompressedgz.html
    • /usr/share/doc/php-manual-en/pharfileinfo.iscrcchecked.html
    • /usr/share/doc/php-manual-en/pharfileinfo.setcompressedbzip2.html
    • /usr/share/doc/php-manual-en/pharfileinfo.setcompressedgz.html
    • /usr/share/doc/php-manual-en/pharfileinfo.setmetadata.html
    • /usr/share/doc/php-manual-en/pharfileinfo.setuncompressed.html
    • /usr/share/doc/php-manual-en/php-user-filter.filter.html
    • /usr/share/doc/php-manual-en/php-user-filter.onclose.html
    • /usr/share/doc/php-manual-en/php-user-filter.oncreate.html
    • /usr/share/doc/php-manual-en/posix.configuration.html
    • /usr/share/doc/php-manual-en/posix.constants.html
    • /usr/share/doc/php-manual-en/posix.installation.html
    • /usr/share/doc/php-manual-en/posix.requirements.html
    • /usr/share/doc/php-manual-en/posix.resources.html
    • /usr/share/doc/php-manual-en/posix.setup.html
    • /usr/share/doc/php-manual-en/preface.html
    • /usr/share/doc/php-manual-en/printer.configuration.html
    • /usr/share/doc/php-manual-en/printer.constants.html
    • /usr/share/doc/php-manual-en/printer.installation.html
    • /usr/share/doc/php-manual-en/printer.requirements.html
    • /usr/share/doc/php-manual-en/printer.resources.html
    • /usr/share/doc/php-manual-en/printer.setup.html
    • /usr/share/doc/php-manual-en/proctitle.configuration.html
    • /usr/share/doc/php-manual-en/proctitle.constants.html
    • /usr/share/doc/php-manual-en/proctitle.installation.html
    • /usr/share/doc/php-manual-en/proctitle.requirements.html
    • /usr/share/doc/php-manual-en/proctitle.resources.html
    • /usr/share/doc/php-manual-en/proctitle.setup.html
    • /usr/share/doc/php-manual-en/ps.configuration.html
    • /usr/share/doc/php-manual-en/ps.constants.html
    • /usr/share/doc/php-manual-en/ps.installation.html
    • /usr/share/doc/php-manual-en/ps.requirements.html
    • /usr/share/doc/php-manual-en/ps.resources.html
    • /usr/share/doc/php-manual-en/ps.setup.html
    • /usr/share/doc/php-manual-en/pspell.configuration.html
    • /usr/share/doc/php-manual-en/pspell.constants.html
    • /usr/share/doc/php-manual-en/pspell.installation.html
    • /usr/share/doc/php-manual-en/pspell.requirements.html
    • /usr/share/doc/php-manual-en/pspell.resources.html
    • /usr/share/doc/php-manual-en/pspell.setup.html
    • /usr/share/doc/php-manual-en/pthreads.configuration.html
    • /usr/share/doc/php-manual-en/pthreads.constants.html
    • /usr/share/doc/php-manual-en/pthreads.installation.html
    • /usr/share/doc/php-manual-en/pthreads.modifiers.html
    • /usr/share/doc/php-manual-en/pthreads.requirements.html
    • /usr/share/doc/php-manual-en/pthreads.resources.html
    • /usr/share/doc/php-manual-en/pthreads.setup.html
    • /usr/share/doc/php-manual-en/qtdom.configuration.html
    • /usr/share/doc/php-manual-en/qtdom.constants.html
    • /usr/share/doc/php-manual-en/qtdom.installation.html
    • /usr/share/doc/php-manual-en/qtdom.requirements.html
    • /usr/share/doc/php-manual-en/qtdom.resources.html
    • /usr/share/doc/php-manual-en/qtdom.setup.html
    • /usr/share/doc/php-manual-en/quickhash.configuration.html
    • /usr/share/doc/php-manual-en/quickhash.constants.html
    • /usr/share/doc/php-manual-en/quickhash.examples.html
    • /usr/share/doc/php-manual-en/quickhash.installation.html
    • /usr/share/doc/php-manual-en/quickhash.requirements.html
    • /usr/share/doc/php-manual-en/quickhash.setup.html
    • /usr/share/doc/php-manual-en/quickhashinthash.add.html
    • /usr/share/doc/php-manual-en/quickhashinthash.construct.html
    • /usr/share/doc/php-manual-en/quickhashinthash.delete.html
    • /usr/share/doc/php-manual-en/quickhashinthash.exists.html
    • /usr/share/doc/php-manual-en/quickhashinthash.get.html
    • /usr/share/doc/php-manual-en/quickhashinthash.getsize.html
    • /usr/share/doc/php-manual-en/quickhashinthash.loadfromfile.html
    • /usr/share/doc/php-manual-en/quickhashinthash.loadfromstring.html
    • /usr/share/doc/php-manual-en/quickhashinthash.savetofile.html
    • /usr/share/doc/php-manual-en/quickhashinthash.savetostring.html
    • /usr/share/doc/php-manual-en/quickhashinthash.set.html
    • /usr/share/doc/php-manual-en/quickhashinthash.update.html
    • /usr/share/doc/php-manual-en/quickhashintset.add.html
    • /usr/share/doc/php-manual-en/quickhashintset.construct.html
    • /usr/share/doc/php-manual-en/quickhashintset.delete.html
    • /usr/share/doc/php-manual-en/quickhashintset.exists.html
    • /usr/share/doc/php-manual-en/quickhashintset.getsize.html
    • /usr/share/doc/php-manual-en/quickhashintset.loadfromfile.html
    • /usr/share/doc/php-manual-en/quickhashintset.loadfromstring.html
    • /usr/share/doc/php-manual-en/quickhashintset.savetofile.html
    • /usr/share/doc/php-manual-en/quickhashintset.savetostring.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.add.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.construct.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.delete.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.exists.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.get.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.getsize.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.loadfromfile.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.loadfromstring.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.savetofile.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.savetostring.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.set.html
    • /usr/share/doc/php-manual-en/quickhashintstringhash.update.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.add.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.construct.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.delete.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.exists.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.get.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.getsize.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.loadfromfile.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.loadfromstring.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.savetofile.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.savetostring.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.set.html
    • /usr/share/doc/php-manual-en/quickhashstringinthash.update.html
    • /usr/share/doc/php-manual-en/radius.configuration.html
    • /usr/share/doc/php-manual-en/radius.constants.attributes.html
    • /usr/share/doc/php-manual-en/radius.constants.html
    • /usr/share/doc/php-manual-en/radius.constants.options.html
    • /usr/share/doc/php-manual-en/radius.constants.packets.html
    • /usr/share/doc/php-manual-en/radius.constants.vendor-specific.html
    • /usr/share/doc/php-manual-en/radius.examples.html
    • /usr/share/doc/php-manual-en/radius.installation.html
    • /usr/share/doc/php-manual-en/radius.requirements.html
    • /usr/share/doc/php-manual-en/radius.resources.html
    • /usr/share/doc/php-manual-en/radius.setup.html
    • /usr/share/doc/php-manual-en/rar.configuration.html
    • /usr/share/doc/php-manual-en/rar.constants.html
    • /usr/share/doc/php-manual-en/rar.examples.html
    • /usr/share/doc/php-manual-en/rar.installation.html
    • /usr/share/doc/php-manual-en/rar.requirements.html
    • /usr/share/doc/php-manual-en/rar.resources.html
    • /usr/share/doc/php-manual-en/rar.setup.html
    • /usr/share/doc/php-manual-en/rararchive.close.html
    • /usr/share/doc/php-manual-en/rararchive.getcomment.html
    • /usr/share/doc/php-manual-en/rararchive.getentries.html
    • /usr/share/doc/php-manual-en/rararchive.getentry.html
    • /usr/share/doc/php-manual-en/rararchive.isbroken.html
    • /usr/share/doc/php-manual-en/rararchive.issolid.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/rararchive.setallowbroken.html
    • /usr/share/doc/php-manual-en/rararchive.tostring.html
    • /usr/share/doc/php-manual-en/rarentry.extract.html
    • /usr/share/doc/php-manual-en/rarentry.getattr.html
    • /usr/share/doc/php-manual-en/rarentry.getcrc.html
    • /usr/share/doc/php-manual-en/rarentry.getfiletime.html
    • /usr/share/doc/php-manual-en/rarentry.gethostos.html
    • /usr/share/doc/php-manual-en/rarentry.getmethod.html
    • /usr/share/doc/php-manual-en/rarentry.getname.html
    • /usr/share/doc/php-manual-en/rarentry.getpackedsize.html
    • /usr/share/doc/php-manual-en/rarentry.getstream.html
    • /usr/share/doc/php-manual-en/rarentry.getunpackedsize.html
    • /usr/share/doc/php-manual-en/rarentry.getversion.html
    • /usr/share/doc/php-manual-en/rarentry.isdirectory.html
    • /usr/share/doc/php-manual-en/rarentry.isencrypted.html
    • /usr/share/doc/php-manual-en/rarentry.tostring.html
    • /usr/share/doc/php-manual-en/rarexception.isusingexceptions.html
    • /usr/share/doc/php-manual-en/rarexception.setusingexceptions.html
    • /usr/share/doc/php-manual-en/readline.configuration.html
    • /usr/share/doc/php-manual-en/readline.constants.html
    • /usr/share/doc/php-manual-en/readline.installation.html
    • /usr/share/doc/php-manual-en/readline.requirements.html
    • /usr/share/doc/php-manual-en/readline.resources.html
    • /usr/share/doc/php-manual-en/readline.setup.html
    • /usr/share/doc/php-manual-en/recode.configuration.html
    • /usr/share/doc/php-manual-en/recode.constants.html
    • /usr/share/doc/php-manual-en/recode.installation.html
    • /usr/share/doc/php-manual-en/recode.requirements.html
    • /usr/share/doc/php-manual-en/recode.resources.html
    • /usr/share/doc/php-manual-en/recode.setup.html
    • /usr/share/doc/php-manual-en/recursivearrayiterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursivearrayiterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursivecachingiterator.construct.html
    • /usr/share/doc/php-manual-en/recursivecachingiterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursivecachingiterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursivecallbackfilteriterator.construct.html
    • /usr/share/doc/php-manual-en/recursivecallbackfilteriterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursivecallbackfilteriterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.construct.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.getsubpath.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.getsubpathname.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/recursivedirectoryiterator.rewind.html
    • /usr/share/doc/php-manual-en/recursivefilteriterator.construct.html
    • /usr/share/doc/php-manual-en/recursivefilteriterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursivefilteriterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursiveiterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursiveiterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.beginchildren.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.beginiteration.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.callgetchildren.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.callhaschildren.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.construct.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.current.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.endchildren.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.enditeration.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.getdepth.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.getinneriterator.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.getmaxdepth.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.getsubiterator.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.nextelement.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.rewind.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.setmaxdepth.html
    • /usr/share/doc/php-manual-en/recursiveiteratoriterator.valid.html
    • /usr/share/doc/php-manual-en/recursiveregexiterator.construct.html
    • /usr/share/doc/php-manual-en/recursiveregexiterator.getchildren.html
    • /usr/share/doc/php-manual-en/recursiveregexiterator.haschildren.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.beginchildren.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.beginiteration.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.callgetchildren.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.callhaschildren.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.construct.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.current.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.endchildren.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.enditeration.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.getentry.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.getpostfix.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.getprefix.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/recursivetreeiterator.nextelement.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.rewind.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.setprefixpart.html
    • /usr/share/doc/php-manual-en/recursivetreeiterator.valid.html
    • /usr/share/doc/php-manual-en/ref.apache.html
    • /usr/share/doc/php-manual-en/ref.apc.html
    • /usr/share/doc/php-manual-en/ref.apd.html
    • /usr/share/doc/php-manual-en/ref.array.html
    • /usr/share/doc/php-manual-en/ref.bbcode.html
    • /usr/share/doc/php-manual-en/ref.bc.html
    • /usr/share/doc/php-manual-en/ref.bcompiler.html
    • /usr/share/doc/php-manual-en/ref.blenc.html
    • /usr/share/doc/php-manual-en/ref.bzip2.html
    • /usr/share/doc/php-manual-en/ref.cairo.html
    • /usr/share/doc/php-manual-en/ref.calendar.html
    • /usr/share/doc/php-manual-en/ref.chdb.html
    • /usr/share/doc/php-manual-en/ref.classkit.html
    • /usr/share/doc/php-manual-en/ref.classobj.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.crack.html
    • /usr/share/doc/php-manual-en/ref.ctype.html
    • /usr/share/doc/php-manual-en/ref.cubrid.html
    • /usr/share/doc/php-manual-en/ref.curl.html
    • /usr/share/doc/php-manual-en/ref.cyrus.html
    • /usr/share/doc/php-manual-en/ref.datetime.html
    • /usr/share/doc/php-manual-en/ref.dba.html
    • /usr/share/doc/php-manual-en/ref.dbase.html
    • /usr/share/doc/php-manual-en/ref.dbplus.html
    • /usr/share/doc/php-manual-en/ref.dbx.html
    • /usr/share/doc/php-manual-en/ref.dio.html
    • /usr/share/doc/php-manual-en/ref.dir.html
    • /usr/share/doc/php-manual-en/ref.dom.html
    • /usr/share/doc/php-manual-en/ref.dotnet.html
    • /usr/share/doc/php-manual-en/ref.eio.html
    • /usr/share/doc/php-manual-en/ref.enchant.html
    • /usr/share/doc/php-manual-en/ref.errorfunc.html
    • /usr/share/doc/php-manual-en/ref.exec.html
    • /usr/share/doc/php-manual-en/ref.exif.html
    • /usr/share/doc/php-manual-en/ref.expect.html
    • /usr/share/doc/php-manual-en/ref.fam.html
    • /usr/share/doc/php-manual-en/ref.fann.html
    • /usr/share/doc/php-manual-en/ref.fbsql.html
    • /usr/share/doc/php-manual-en/ref.fdf.html
    • /usr/share/doc/php-manual-en/ref.fileinfo.html
    • /usr/share/doc/php-manual-en/ref.filepro.html
    • /usr/share/doc/php-manual-en/ref.filesystem.html
    • /usr/share/doc/php-manual-en/ref.filter.html
    • /usr/share/doc/php-manual-en/ref.fpm.html
    • /usr/share/doc/php-manual-en/ref.fribidi.html
    • /usr/share/doc/php-manual-en/ref.ftp.html
    • /usr/share/doc/php-manual-en/ref.funchand.html
    • /usr/share/doc/php-manual-en/ref.geoip.html
    • /usr/share/doc/php-manual-en/ref.gettext.html
    • /usr/share/doc/php-manual-en/ref.gmp.html
    • /usr/share/doc/php-manual-en/ref.gnupg.html
    • /usr/share/doc/php-manual-en/ref.gupnp.html
    • /usr/share/doc/php-manual-en/ref.hash.html
    • /usr/share/doc/php-manual-en/ref.http.html
    • /usr/share/doc/php-manual-en/ref.hw.html
    • /usr/share/doc/php-manual-en/ref.hwapi.html
    • /usr/share/doc/php-manual-en/ref.ibase.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.iconv.html
    • /usr/share/doc/php-manual-en/ref.id3.html
    • /usr/share/doc/php-manual-en/ref.ifx.html
    • /usr/share/doc/php-manual-en/ref.iisfunc.html
    • /usr/share/doc/php-manual-en/ref.image.html
    • /usr/share/doc/php-manual-en/ref.imap.html
    • /usr/share/doc/php-manual-en/ref.inclued.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.ingres.html
    • /usr/share/doc/php-manual-en/ref.inotify.html
    • /usr/share/doc/php-manual-en/ref.intl.grapheme.html
    • /usr/share/doc/php-manual-en/ref.intl.html
    • /usr/share/doc/php-manual-en/ref.intl.idn.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.json.html
    • /usr/share/doc/php-manual-en/ref.judy.html
    • /usr/share/doc/php-manual-en/ref.kadm5.html
    • /usr/share/doc/php-manual-en/ref.ldap.html
    • /usr/share/doc/php-manual-en/ref.libevent.html
    • /usr/share/doc/php-manual-en/ref.libxml.html
    • /usr/share/doc/php-manual-en/ref.lzf.html
    • /usr/share/doc/php-manual-en/ref.mail.html
    • /usr/share/doc/php-manual-en/ref.mailparse.html
    • /usr/share/doc/php-manual-en/ref.math.html
    • /usr/share/doc/php-manual-en/ref.maxdb.html
    • /usr/share/doc/php-manual-en/ref.mbstring.html
    • /usr/share/doc/php-manual-en/ref.mcrypt.html
    • /usr/share/doc/php-manual-en/ref.mcve.html
    • /usr/share/doc/php-manual-en/ref.memcache.html
    • /usr/share/doc/php-manual-en/ref.mhash.html
    • /usr/share/doc/php-manual-en/ref.ming.html
    • /usr/share/doc/php-manual-en/ref.misc.html
    • /usr/share/doc/php-manual-en/ref.mnogosearch.html
    • /usr/share/doc/php-manual-en/ref.mongo.html
    • /usr/share/doc/php-manual-en/ref.mqseries.html
    • /usr/share/doc/php-manual-en/ref.msession.html
    • /usr/share/doc/php-manual-en/ref.msql.html
    • /usr/share/doc/php-manual-en/ref.mssql.html
    • /usr/share/doc/php-manual-en/ref.mysql.html
    • /usr/share/doc/php-manual-en/ref.mysqli.html
    • /usr/share/doc/php-manual-en/ref.mysqlnd-memcache.html
    • /usr/share/doc/php-manual-en/ref.mysqlnd-ms.html
    • /usr/share/doc/php-manual-en/ref.mysqlnd-qc.html
    • /usr/share/doc/php-manual-en/ref.mysqlnd-uh.html
    • /usr/share/doc/php-manual-en/ref.ncurses.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.newt.html
    • /usr/share/doc/php-manual-en/ref.nis.html
    • /usr/share/doc/php-manual-en/ref.notes.html
    • /usr/share/doc/php-manual-en/ref.nsapi.html
    • /usr/share/doc/php-manual-en/ref.oauth.html
    • /usr/share/doc/php-manual-en/ref.objaggregation.html
    • /usr/share/doc/php-manual-en/ref.oci8.html
    • /usr/share/doc/php-manual-en/ref.opcache.html
    • /usr/share/doc/php-manual-en/ref.openal.html
    • /usr/share/doc/php-manual-en/ref.openssl.html
    • /usr/share/doc/php-manual-en/ref.outcontrol.html
    • /usr/share/doc/php-manual-en/ref.ovrimos.html
    • /usr/share/doc/php-manual-en/ref.paradox.html
    • /usr/share/doc/php-manual-en/ref.parsekit.html
    • /usr/share/doc/php-manual-en/ref.password.html
    • /usr/share/doc/php-manual-en/ref.pcntl.html
    • /usr/share/doc/php-manual-en/ref.pcre.html
    • /usr/share/doc/php-manual-en/ref.pdf.html
    • /usr/share/doc/php-manual-en/ref.pdo-4d.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-4d.html
    • /usr/share/doc/php-manual-en/ref.pdo-4d.sql4d.html
    • /usr/share/doc/php-manual-en/ref.pdo-cubrid.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-cubrid.html
    • /usr/share/doc/php-manual-en/ref.pdo-dblib.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-dblib.html
    • /usr/share/doc/php-manual-en/ref.pdo-firebird.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-firebird.html
    • /usr/share/doc/php-manual-en/ref.pdo-ibm.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-ibm.html
    • /usr/share/doc/php-manual-en/ref.pdo-informix.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-informix.html
    • /usr/share/doc/php-manual-en/ref.pdo-mysql.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-mysql.html
    • /usr/share/doc/php-manual-en/ref.pdo-oci.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-oci.html
    • /usr/share/doc/php-manual-en/ref.pdo-odbc.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-odbc.html
    • /usr/share/doc/php-manual-en/ref.pdo-pgsql.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-pgsql.html
    • /usr/share/doc/php-manual-en/ref.pdo-sqlite.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-sqlite.html
    • /usr/share/doc/php-manual-en/ref.pdo-sqlsrv.connection.html
    • /usr/share/doc/php-manual-en/ref.pdo-sqlsrv.html
    • /usr/share/doc/php-manual-en/ref.pgsql.html
    • /usr/share/doc/php-manual-en/ref.posix.html
    • /usr/share/doc/php-manual-en/ref.printer.html
    • /usr/share/doc/php-manual-en/ref.proctitle.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.pspell.html
    • /usr/share/doc/php-manual-en/ref.qtdom.html
    • /usr/share/doc/php-manual-en/ref.radius.html
    • /usr/share/doc/php-manual-en/ref.rar.html
    • /usr/share/doc/php-manual-en/ref.readline.html
    • /usr/share/doc/php-manual-en/ref.recode.html
    • /usr/share/doc/php-manual-en/ref.regex.html
    • /usr/share/doc/php-manual-en/ref.rpmreader.html
    • /usr/share/doc/php-manual-en/ref.rrd.html
    • /usr/share/doc/php-manual-en/ref.runkit.html
    • /usr/share/doc/php-manual-en/ref.sam.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.sdo-das-xml.html
    • /usr/share/doc/php-manual-en/ref.sdo.html
    • /usr/share/doc/php-manual-en/ref.sdodasrel.html
    • /usr/share/doc/php-manual-en/ref.sem.html
    • /usr/share/doc/php-manual-en/ref.session-pgsql.html
    • /usr/share/doc/php-manual-en/ref.session.html
    • /usr/share/doc/php-manual-en/ref.shmop.html
    • /usr/share/doc/php-manual-en/ref.simplexml.html
    • /usr/share/doc/php-manual-en/ref.snmp.html
    • /usr/share/doc/php-manual-en/ref.soap.html
    • /usr/share/doc/php-manual-en/ref.sockets.html
    • /usr/share/doc/php-manual-en/ref.solr.html
    • /usr/share/doc/php-manual-en/ref.spl.html
    • /usr/share/doc/php-manual-en/ref.spplus.html
    • /usr/share/doc/php-manual-en/ref.sqlite.html
    • /usr/share/doc/php-manual-en/ref.sqlsrv.html
    • /usr/share/doc/php-manual-en/ref.ssdeep.html
    • /usr/share/doc/php-manual-en/ref.ssh2.html
    • /usr/share/doc/php-manual-en/ref.stats.html
    • /usr/share/doc/php-manual-en/ref.stomp.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.strings.html
    • /usr/share/doc/php-manual-en/ref.svn.html
    • /usr/share/doc/php-manual-en/ref.swf.html
    • /usr/share/doc/php-manual-en/ref.swish.html
    • /usr/share/doc/php-manual-en/ref.sybase.html
    • /usr/share/doc/php-manual-en/ref.taint.html
    • /usr/share/doc/php-manual-en/ref.tcpwrap.html
    • /usr/share/doc/php-manual-en/ref.tidy.html
    • /usr/share/doc/php-manual-en/ref.tokenizer.html
    • /usr/share/doc/php-manual-en/ref.trader.html
    • /usr/share/doc/php-manual-en/ref.uodbc.html
    • /usr/share/doc/php-manual-en/ref.url.html
    • /usr/share/doc/php-manual-en/ref.var.html
    • /usr/share/doc/php-manual-en/ref.vpopmail.html
    • /usr/share/doc/php-manual-en/ref.w32api.html
    • /usr/share/doc/php-manual-en/ref.wddx.html
    • /usr/share/doc/php-manual-en/ref.win32ps.html
    • /usr/share/doc/php-manual-en/ref.win32service.html
    • /usr/share/doc/php-manual-en/ref.wincache.html
    • /usr/share/doc/php-manual-en/ref.xattr.html
    • /usr/share/doc/php-manual-en/ref.xdiff.html
    • /usr/share/doc/php-manual-en/ref.xhprof.html
    • /usr/share/doc/php-manual-en/ref.xml.html
    • /usr/share/doc/php-manual-en/ref.xmlrpc.html
    • /usr/share/doc/php-manual-en/ref.xmlwriter.html
    • /usr/share/doc/php-manual-en/ref.xslt.html
    • /usr/share/doc/php-manual-en/ref.yaml.html
    • /usr/share/doc/php-manual-en/ref.yaz.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ref.zlib.html
    • /usr/share/doc/php-manual-en/reference.pcre.pattern.differences.html
    • /usr/share/doc/php-manual-en/reference.pcre.pattern.modifiers.html
    • /usr/share/doc/php-manual-en/reference.pcre.pattern.posix.html
    • /usr/share/doc/php-manual-en/reference.pcre.pattern.syntax.html
    • /usr/share/doc/php-manual-en/reflection.configuration.html
    • /usr/share/doc/php-manual-en/reflection.constants.html
    • /usr/share/doc/php-manual-en/reflection.examples.html
    • /usr/share/doc/php-manual-en/reflection.export.html
    • /usr/share/doc/php-manual-en/reflection.extending.html
    • /usr/share/doc/php-manual-en/reflection.getmodifiernames.html
    • /usr/share/doc/php-manual-en/reflection.installation.html
    • /usr/share/doc/php-manual-en/reflection.requirements.html
    • /usr/share/doc/php-manual-en/reflection.resources.html
    • /usr/share/doc/php-manual-en/reflection.setup.html
    • /usr/share/doc/php-manual-en/reflectionclass.construct.html
    • /usr/share/doc/php-manual-en/reflectionclass.export.html
    • /usr/share/doc/php-manual-en/reflectionclass.getconstant.html
    • /usr/share/doc/php-manual-en/reflectionclass.getconstants.html
    • /usr/share/doc/php-manual-en/reflectionclass.getconstructor.html
    • /usr/share/doc/php-manual-en/reflectionclass.getdefaultproperties.html
    • /usr/share/doc/php-manual-en/reflectionclass.getdoccomment.html
    • /usr/share/doc/php-manual-en/reflectionclass.getendline.html
    • /usr/share/doc/php-manual-en/reflectionclass.getextension.html
    • /usr/share/doc/php-manual-en/reflectionclass.getextensionname.html
    • /usr/share/doc/php-manual-en/reflectionclass.getfilename.html
    • /usr/share/doc/php-manual-en/reflectionclass.getinterfacenames.html
    • /usr/share/doc/php-manual-en/reflectionclass.getinterfaces.html
    • /usr/share/doc/php-manual-en/reflectionclass.getmethod.html
    • /usr/share/doc/php-manual-en/reflectionclass.getmethods.html
    • /usr/share/doc/php-manual-en/reflectionclass.getmodifiers.html
    • /usr/share/doc/php-manual-en/reflectionclass.getname.html
    • /usr/share/doc/php-manual-en/reflectionclass.getnamespacename.html
    • /usr/share/doc/php-manual-en/reflectionclass.getparentclass.html
    • /usr/share/doc/php-manual-en/reflectionclass.getproperties.html
    • /usr/share/doc/php-manual-en/reflectionclass.getproperty.html
    • /usr/share/doc/php-manual-en/reflectionclass.getshortname.html
    • /usr/share/doc/php-manual-en/reflectionclass.getstartline.html
    • /usr/share/doc/php-manual-en/reflectionclass.getstaticproperties.html
    • /usr/share/doc/php-manual-en/reflectionclass.getstaticpropertyvalue.html
    • /usr/share/doc/php-manual-en/reflectionclass.gettraitaliases.html
    • /usr/share/doc/php-manual-en/reflectionclass.gettraitnames.html
    • /usr/share/doc/php-manual-en/reflectionclass.gettraits.html
    • /usr/share/doc/php-manual-en/reflectionclass.hasconstant.html
    • /usr/share/doc/php-manual-en/reflectionclass.hasmethod.html
    • /usr/share/doc/php-manual-en/reflectionclass.hasproperty.html
    • /usr/share/doc/php-manual-en/reflectionclass.implementsinterface.html
    • /usr/share/doc/php-manual-en/reflectionclass.innamespace.html
    • /usr/share/doc/php-manual-en/reflectionclass.isabstract.html
    • /usr/share/doc/php-manual-en/reflectionclass.iscloneable.html
    • /usr/share/doc/php-manual-en/reflectionclass.isfinal.html
    • /usr/share/doc/php-manual-en/reflectionclass.isinstance.html
    • /usr/share/doc/php-manual-en/reflectionclass.isinstantiable.html
    • /usr/share/doc/php-manual-en/reflectionclass.isinterface.html
    • /usr/share/doc/php-manual-en/reflectionclass.isinternal.html
    • /usr/share/doc/php-manual-en/reflectionclass.isiterateable.html
    • /usr/share/doc/php-manual-en/reflectionclass.issubclassof.html
    • /usr/share/doc/php-manual-en/reflectionclass.istrait.html
    • /usr/share/doc/php-manual-en/reflectionclass.isuserdefined.html
    • /usr/share/doc/php-manual-en/reflectionclass.newinstance.html
    • /usr/share/doc/php-manual-en/reflectionclass.newinstanceargs.html
    • /usr/share/doc/php-manual-en/reflectionclass.newinstancewithoutconstructor.html
    • /usr/share/doc/php-manual-en/reflectionclass.setstaticpropertyvalue.html
    • /usr/share/doc/php-manual-en/reflectionclass.tostring.html
    • /usr/share/doc/php-manual-en/reflectionextension.clone.html
    • /usr/share/doc/php-manual-en/reflectionextension.construct.html
    • /usr/share/doc/php-manual-en/reflectionextension.export.html
    • /usr/share/doc/php-manual-en/reflectionextension.getclasses.html
    • /usr/share/doc/php-manual-en/reflectionextension.getclassnames.html
    • /usr/share/doc/php-manual-en/reflectionextension.getconstants.html
    • /usr/share/doc/php-manual-en/reflectionextension.getdependencies.html
    • /usr/share/doc/php-manual-en/reflectionextension.getfunctions.html
    • /usr/share/doc/php-manual-en/reflectionextension.getinientries.html
    • /usr/share/doc/php-manual-en/reflectionextension.getname.html
    • /usr/share/doc/php-manual-en/reflectionextension.getversion.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/reflectionextension.ispersistent.html
    • /usr/share/doc/php-manual-en/reflectionextension.istemporary.html
    • /usr/share/doc/php-manual-en/reflectionextension.tostring.html
    • /usr/share/doc/php-manual-en/reflectionfunction.construct.html
    • /usr/share/doc/php-manual-en/reflectionfunction.export.html
    • /usr/share/doc/php-manual-en/reflectionfunction.getclosure.html
    • /usr/share/doc/php-manual-en/reflectionfunction.invoke.html
    • /usr/share/doc/php-manual-en/reflectionfunction.invokeargs.html
    • /usr/share/doc/php-manual-en/reflectionfunction.isdisabled.html
    • /usr/share/doc/php-manual-en/reflectionfunction.tostring.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.clone.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getclosurescopeclass.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getclosurethis.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getdoccomment.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getendline.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getextension.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getextensionname.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getfilename.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getname.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getnamespacename.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getnumberofparameters.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getnumberofrequiredparameters.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getparameters.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getshortname.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getstartline.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.getstaticvariables.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.innamespace.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.isclosure.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.isdeprecated.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.isgenerator.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.isinternal.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.isuserdefined.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.returnsreference.html
    • /usr/share/doc/php-manual-en/reflectionfunctionabstract.tostring.html
    • /usr/share/doc/php-manual-en/reflectionmethod.construct.html
    • /usr/share/doc/php-manual-en/reflectionmethod.export.html
    • /usr/share/doc/php-manual-en/reflectionmethod.getclosure.html
    • /usr/share/doc/php-manual-en/reflectionmethod.getdeclaringclass.html
    • /usr/share/doc/php-manual-en/reflectionmethod.getmodifiers.html
    • /usr/share/doc/php-manual-en/reflectionmethod.getprototype.html
    • /usr/share/doc/php-manual-en/reflectionmethod.invoke.html
    • /usr/share/doc/php-manual-en/reflectionmethod.invokeargs.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isabstract.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isconstructor.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isdestructor.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isfinal.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isprivate.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isprotected.html
    • /usr/share/doc/php-manual-en/reflectionmethod.ispublic.html
    • /usr/share/doc/php-manual-en/reflectionmethod.isstatic.html
    • /usr/share/doc/php-manual-en/reflectionmethod.setaccessible.html
    • /usr/share/doc/php-manual-en/reflectionmethod.tostring.html
    • /usr/share/doc/php-manual-en/reflectionobject.construct.html
    • /usr/share/doc/php-manual-en/reflectionobject.export.html
    • /usr/share/doc/php-manual-en/reflectionparameter.allowsnull.html
    • /usr/share/doc/php-manual-en/reflectionparameter.canbepassedbyvalue.html
    • /usr/share/doc/php-manual-en/reflectionparameter.clone.html
    • /usr/share/doc/php-manual-en/reflectionparameter.construct.html
    • /usr/share/doc/php-manual-en/reflectionparameter.export.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getclass.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getdeclaringclass.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getdeclaringfunction.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getdefaultvalue.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getdefaultvalueconstantname.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getname.html
    • /usr/share/doc/php-manual-en/reflectionparameter.getposition.html
    • /usr/share/doc/php-manual-en/reflectionparameter.isarray.html
    • /usr/share/doc/php-manual-en/reflectionparameter.iscallable.html
    • /usr/share/doc/php-manual-en/reflectionparameter.isdefaultvalueavailable.html
    • /usr/share/doc/php-manual-en/reflectionparameter.isdefaultvalueconstant.html
    • /usr/share/doc/php-manual-en/reflectionparameter.isoptional.html
    • /usr/share/doc/php-manual-en/reflectionparameter.ispassedbyreference.html
    • /usr/share/doc/php-manual-en/reflectionparameter.tostring.html
    • /usr/share/doc/php-manual-en/reflectionproperty.clone.html
    • /usr/share/doc/php-manual-en/reflectionproperty.construct.html
    • /usr/share/doc/php-manual-en/reflectionproperty.export.html
    • /usr/share/doc/php-manual-en/reflectionproperty.getdeclaringclass.html
    • /usr/share/doc/php-manual-en/reflectionproperty.getdoccomment.html
    • /usr/share/doc/php-manual-en/reflectionproperty.getmodifiers.html
    • /usr/share/doc/php-manual-en/reflectionproperty.getname.html
    • /usr/share/doc/php-manual-en/reflectionproperty.getvalue.html
    • /usr/share/doc/php-manual-en/reflectionproperty.isdefault.html
    • /usr/share/doc/php-manual-en/reflectionproperty.isprivate.html
    • /usr/share/doc/php-manual-en/reflectionproperty.isprotected.html
    • /usr/share/doc/php-manual-en/reflectionproperty.ispublic.html
    • /usr/share/doc/php-manual-en/reflectionproperty.isstatic.html
    • /usr/share/doc/php-manual-en/reflectionproperty.setaccessible.html
    • /usr/share/doc/php-manual-en/reflectionproperty.setvalue.html
    • /usr/share/doc/php-manual-en/reflectionproperty.tostring.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.clone.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.construct.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.export.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.getauthor.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.getcopyright.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.getname.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.geturl.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.getversion.html
    • /usr/share/doc/php-manual-en/reflectionzendextension.tostring.html
    • /usr/share/doc/php-manual-en/reflector.export.html
    • /usr/share/doc/php-manual-en/reflector.tostring.html
    • /usr/share/doc/php-manual-en/refs.basic.other.html
    • /usr/share/doc/php-manual-en/refs.basic.php.html
    • /usr/share/doc/php-manual-en/refs.basic.session.html
    • /usr/share/doc/php-manual-en/refs.basic.text.html
    • /usr/share/doc/php-manual-en/refs.basic.vartype.html
    • /usr/share/doc/php-manual-en/refs.calendar.html
    • /usr/share/doc/php-manual-en/refs.compression.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/refs.crypto.html
    • /usr/share/doc/php-manual-en/refs.database.abstract.html
    • /usr/share/doc/php-manual-en/refs.database.html
    • /usr/share/doc/php-manual-en/refs.database.vendors.html
    • /usr/share/doc/php-manual-en/refs.fileprocess.file.html
    • /usr/share/doc/php-manual-en/refs.fileprocess.process.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/refs.math.html
    • /usr/share/doc/php-manual-en/refs.remote.auth.html
    • /usr/share/doc/php-manual-en/refs.remote.mail.html
    • /usr/share/doc/php-manual-en/refs.remote.other.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/refs.utilspec.cmdline.html
    • /usr/share/doc/php-manual-en/refs.utilspec.image.html
    • /usr/share/doc/php-manual-en/refs.utilspec.nontext.html
    • /usr/share/doc/php-manual-en/refs.utilspec.server.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/refs.webservice.html
    • /usr/share/doc/php-manual-en/refs.xml.html
    • /usr/share/doc/php-manual-en/regex.configuration.html
    • /usr/share/doc/php-manual-en/regex.constants.html
    • /usr/share/doc/php-manual-en/regex.examples.html
    • /usr/share/doc/php-manual-en/regex.installation.html
    • /usr/share/doc/php-manual-en/regex.requirements.html
    • /usr/share/doc/php-manual-en/regex.resources.html
    • /usr/share/doc/php-manual-en/regex.setup.html
    • /usr/share/doc/php-manual-en/regexiterator.accept.html
    • /usr/share/doc/php-manual-en/regexiterator.construct.html
    • /usr/share/doc/php-manual-en/regexiterator.getflags.html
    • /usr/share/doc/php-manual-en/regexiterator.getmode.html
    • /usr/share/doc/php-manual-en/regexiterator.getpregflags.html
    • /usr/share/doc/php-manual-en/regexiterator.getregex.html
    • /usr/share/doc/php-manual-en/regexiterator.setflags.html
    • /usr/share/doc/php-manual-en/regexiterator.setmode.html
    • /usr/share/doc/php-manual-en/regexiterator.setpregflags.html
    • /usr/share/doc/php-manual-en/regexp.introduction.html
    • /usr/share/doc/php-manual-en/regexp.reference.alternation.html
    • /usr/share/doc/php-manual-en/regexp.reference.anchors.html
    • /usr/share/doc/php-manual-en/regexp.reference.assertions.html
    • /usr/share/doc/php-manual-en/regexp.reference.back-references.html
    • /usr/share/doc/php-manual-en/regexp.reference.character-classes.html
    • /usr/share/doc/php-manual-en/regexp.reference.comments.html
    • /usr/share/doc/php-manual-en/regexp.reference.conditional.html
    • /usr/share/doc/php-manual-en/regexp.reference.delimiters.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/regexp.reference.escape.html
    • /usr/share/doc/php-manual-en/regexp.reference.internal-options.html
    • /usr/share/doc/php-manual-en/regexp.reference.meta.html
    • /usr/share/doc/php-manual-en/regexp.reference.onlyonce.html
    • /usr/share/doc/php-manual-en/regexp.reference.performance.html
    • /usr/share/doc/php-manual-en/regexp.reference.recursive.html
    • /usr/share/doc/php-manual-en/regexp.reference.repetition.html
    • /usr/share/doc/php-manual-en/regexp.reference.subpatterns.html
    • /usr/share/doc/php-manual-en/regexp.reference.unicode.html
    • /usr/share/doc/php-manual-en/reserved.classes.html
    • /usr/share/doc/php-manual-en/reserved.constants.html
    • /usr/share/doc/php-manual-en/reserved.exceptions.html
    • /usr/share/doc/php-manual-en/reserved.html
    • /usr/share/doc/php-manual-en/reserved.interfaces.html
    • /usr/share/doc/php-manual-en/reserved.keywords.html
    • /usr/share/doc/php-manual-en/reserved.variables.argc.html
    • /usr/share/doc/php-manual-en/reserved.variables.argv.html
    • /usr/share/doc/php-manual-en/reserved.variables.cookies.html
    • /usr/share/doc/php-manual-en/reserved.variables.environment.html
    • /usr/share/doc/php-manual-en/reserved.variables.files.html
    • /usr/share/doc/php-manual-en/reserved.variables.get.html
    • /usr/share/doc/php-manual-en/reserved.variables.globals.html
    • /usr/share/doc/php-manual-en/reserved.variables.html
    • /usr/share/doc/php-manual-en/reserved.variables.httprawpostdata.html
    • /usr/share/doc/php-manual-en/reserved.variables.httpresponseheader.html
    • /usr/share/doc/php-manual-en/reserved.variables.phperrormsg.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/reserved.variables.request.html
    • /usr/share/doc/php-manual-en/reserved.variables.server.html
    • /usr/share/doc/php-manual-en/reserved.variables.session.html
    • /usr/share/doc/php-manual-en/resource.html
    • /usr/share/doc/php-manual-en/resourcebundle.count.html
    • /usr/share/doc/php-manual-en/resourcebundle.create.html
    • /usr/share/doc/php-manual-en/resourcebundle.get.html
    • /usr/share/doc/php-manual-en/resourcebundle.geterrorcode.html
    • /usr/share/doc/php-manual-en/resourcebundle.geterrormessage.html
    • /usr/share/doc/php-manual-en/resourcebundle.locales.html
    • /usr/share/doc/php-manual-en/rpmreader.configuration.html
    • /usr/share/doc/php-manual-en/rpmreader.constants.html
    • /usr/share/doc/php-manual-en/rpmreader.examples-basic.html
    • /usr/share/doc/php-manual-en/rpmreader.examples.html
    • /usr/share/doc/php-manual-en/rpmreader.installation.html
    • /usr/share/doc/php-manual-en/rpmreader.requirements.html
    • /usr/share/doc/php-manual-en/rpmreader.resources.html
    • /usr/share/doc/php-manual-en/rpmreader.setup.html
    • /usr/share/doc/php-manual-en/rrd.configuration.html
    • /usr/share/doc/php-manual-en/rrd.constants.html
    • /usr/share/doc/php-manual-en/rrd.examples-oop.html
    • /usr/share/doc/php-manual-en/rrd.examples-procedural.html
    • /usr/share/doc/php-manual-en/rrd.examples.html
    • /usr/share/doc/php-manual-en/rrd.installation.html
    • /usr/share/doc/php-manual-en/rrd.requirements.html
    • /usr/share/doc/php-manual-en/rrd.resources.html
    • /usr/share/doc/php-manual-en/rrd.setup.html
    • /usr/share/doc/php-manual-en/rrdcreator.addarchive.html
    • /usr/share/doc/php-manual-en/rrdcreator.adddatasource.html
    • /usr/share/doc/php-manual-en/rrdcreator.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/rrdgraph.construct.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/rrdgraph.saveverbose.html
    • /usr/share/doc/php-manual-en/rrdgraph.setoptions.html
    • /usr/share/doc/php-manual-en/rrdupdater.construct.html
    • /usr/share/doc/php-manual-en/rrdupdater.update.html
    • /usr/share/doc/php-manual-en/runkit.configuration.html
    • /usr/share/doc/php-manual-en/runkit.constants.html
    • /usr/share/doc/php-manual-en/runkit.installation.html
    • /usr/share/doc/php-manual-en/runkit.requirements.html
    • /usr/share/doc/php-manual-en/runkit.resources.html
    • /usr/share/doc/php-manual-en/runkit.sandbox-parent.html
    • /usr/share/doc/php-manual-en/runkit.sandbox.html
    • /usr/share/doc/php-manual-en/runkit.setup.html
    • /usr/share/doc/php-manual-en/sam.configuration.html
    • /usr/share/doc/php-manual-en/sam.connections.html
    • /usr/share/doc/php-manual-en/sam.constants.html
    • /usr/share/doc/php-manual-en/sam.errors.html
    • /usr/share/doc/php-manual-en/sam.examples.html
    • /usr/share/doc/php-manual-en/sam.installation.html
    • /usr/share/doc/php-manual-en/sam.messages.html
    • /usr/share/doc/php-manual-en/sam.operations.html
    • /usr/share/doc/php-manual-en/sam.pubsub.html
    • /usr/share/doc/php-manual-en/sam.requirements.html
    • /usr/share/doc/php-manual-en/sam.resources.html
    • /usr/share/doc/php-manual-en/sam.setup.html
    • /usr/share/doc/php-manual-en/samconnection.commit.html
    • /usr/share/doc/php-manual-en/samconnection.connect.html
    • /usr/share/doc/php-manual-en/samconnection.construct.html
    • /usr/share/doc/php-manual-en/samconnection.disconnect.html
    • /usr/share/doc/php-manual-en/samconnection.errno.html
    • /usr/share/doc/php-manual-en/samconnection.error.html
    • /usr/share/doc/php-manual-en/samconnection.isconnected.html
    • /usr/share/doc/php-manual-en/samconnection.peek.html
    • /usr/share/doc/php-manual-en/samconnection.peekall.html
    • /usr/share/doc/php-manual-en/samconnection.receive.html
    • /usr/share/doc/php-manual-en/samconnection.remove.html
    • /usr/share/doc/php-manual-en/samconnection.rollback.html
    • /usr/share/doc/php-manual-en/samconnection.send.html
    • /usr/share/doc/php-manual-en/samconnection.setdebug.html
    • /usr/share/doc/php-manual-en/samconnection.subscribe.html
    • /usr/share/doc/php-manual-en/samconnection.unsubscribe.html
    • /usr/share/doc/php-manual-en/sammessage.body.html
    • /usr/share/doc/php-manual-en/sammessage.construct.html
    • /usr/share/doc/php-manual-en/sammessage.header.html
    • /usr/share/doc/php-manual-en/sca-localproxy.createdataobject.html
    • /usr/share/doc/php-manual-en/sca-soapproxy.createdataobject.html
    • /usr/share/doc/php-manual-en/sca.configuration.html
    • /usr/share/doc/php-manual-en/sca.constants.html
    • /usr/share/doc/php-manual-en/sca.createdataobject.html
    • /usr/share/doc/php-manual-en/sca.examples.calling.html
    • /usr/share/doc/php-manual-en/sca.examples.deploy.html
    • /usr/share/doc/php-manual-en/sca.examples.errorhandling.html
    • /usr/share/doc/php-manual-en/sca.examples.exposing-webservice.html
    • /usr/share/doc/php-manual-en/sca.examples.html
    • /usr/share/doc/php-manual-en/sca.examples.nonscascript.html
    • /usr/share/doc/php-manual-en/sca.examples.obtaining-wsdl.html
    • /usr/share/doc/php-manual-en/sca.examples.proxies.html
    • /usr/share/doc/php-manual-en/sca.examples.structure.html
    • /usr/share/doc/php-manual-en/sca.examples.structures.html
    • /usr/share/doc/php-manual-en/sca.examples.understanding-wsdl.html
    • /usr/share/doc/php-manual-en/sca.getservice.html
    • /usr/share/doc/php-manual-en/sca.installation.html
    • /usr/share/doc/php-manual-en/sca.requirements.html
    • /usr/share/doc/php-manual-en/sca.resources.html
    • /usr/share/doc/php-manual-en/sca.setup.html
    • /usr/share/doc/php-manual-en/scream.configuration.html
    • /usr/share/doc/php-manual-en/scream.examples-simple.html
    • /usr/share/doc/php-manual-en/scream.examples.html
    • /usr/share/doc/php-manual-en/scream.installation.html
    • /usr/share/doc/php-manual-en/scream.requirements.html
    • /usr/share/doc/php-manual-en/scream.resources.html
    • /usr/share/doc/php-manual-en/scream.setup.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.beginlogging.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.endlogging.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.getchangeddataobjects.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.getchangetype.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.getoldcontainer.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.getoldvalues.html
    • /usr/share/doc/php-manual-en/sdo-das-changesummary.islogging.html
    • /usr/share/doc/php-manual-en/sdo-das-datafactory.addpropertytotype.html
    • /usr/share/doc/php-manual-en/sdo-das-datafactory.addtype.html
    • /usr/share/doc/php-manual-en/sdo-das-datafactory.getdatafactory.html
    • /usr/share/doc/php-manual-en/sdo-das-dataobject.getchangesummary.html
    • /usr/share/doc/php-manual-en/sdo-das-relational.applychanges.html
    • /usr/share/doc/php-manual-en/sdo-das-relational.construct.html
    • /usr/share/doc/php-manual-en/sdo-das-relational.createrootdataobject.html
    • /usr/share/doc/php-manual-en/sdo-das-relational.executepreparedquery.html
    • /usr/share/doc/php-manual-en/sdo-das-relational.executequery.html
    • /usr/share/doc/php-manual-en/sdo-das-setting.getlistindex.html
    • /usr/share/doc/php-manual-en/sdo-das-setting.getpropertyindex.html
    • /usr/share/doc/php-manual-en/sdo-das-setting.getpropertyname.html
    • /usr/share/doc/php-manual-en/sdo-das-setting.getvalue.html
    • /usr/share/doc/php-manual-en/sdo-das-setting.isset.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.getrootdataobject.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.getrootelementname.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.getrootelementuri.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.setencoding.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.setxmldeclaration.html
    • /usr/share/doc/php-manual-en/sdo-das-xml-document.setxmlversion.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.addtypes.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.configuration.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.constants.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.create.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.createdataobject.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.createdocument.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.examples.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.installation.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.loadfile.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.loadstring.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.requirements.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.resources.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.savefile.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.savestring.html
    • /usr/share/doc/php-manual-en/sdo-das-xml.setup.html
    • /usr/share/doc/php-manual-en/sdo-datafactory.create.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.clear.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.createdataobject.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.getcontainer.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.getsequence.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.gettypename.html
    • /usr/share/doc/php-manual-en/sdo-dataobject.gettypenamespaceuri.html
    • /usr/share/doc/php-manual-en/sdo-exception.getcause.html
    • /usr/share/doc/php-manual-en/sdo-list.insert.html
    • /usr/share/doc/php-manual-en/sdo-model-property.getcontainingtype.html
    • /usr/share/doc/php-manual-en/sdo-model-property.getdefault.html
    • /usr/share/doc/php-manual-en/sdo-model-property.getname.html
    • /usr/share/doc/php-manual-en/sdo-model-property.gettype.html
    • /usr/share/doc/php-manual-en/sdo-model-property.iscontainment.html
    • /usr/share/doc/php-manual-en/sdo-model-property.ismany.html
    • /usr/share/doc/php-manual-en/sdo-model-reflectiondataobject.construct.html
    • /usr/share/doc/php-manual-en/sdo-model-reflectiondataobject.export.html
    • /usr/share/doc/php-manual-en/sdo-model-reflectiondataobject.getcontainmentproperty.html
    • /usr/share/doc/php-manual-en/sdo-model-reflectiondataobject.getinstanceproperties.html
    • /usr/share/doc/php-manual-en/sdo-model-reflectiondataobject.gettype.html
    • /usr/share/doc/php-manual-en/sdo-model-type.getbasetype.html
    • /usr/share/doc/php-manual-en/sdo-model-type.getname.html
    • /usr/share/doc/php-manual-en/sdo-model-type.getnamespaceuri.html
    • /usr/share/doc/php-manual-en/sdo-model-type.getproperties.html
    • /usr/share/doc/php-manual-en/sdo-model-type.getproperty.html
    • /usr/share/doc/php-manual-en/sdo-model-type.isabstracttype.html
    • /usr/share/doc/php-manual-en/sdo-model-type.isdatatype.html
    • /usr/share/doc/php-manual-en/sdo-model-type.isinstance.html
    • /usr/share/doc/php-manual-en/sdo-model-type.isopentype.html
    • /usr/share/doc/php-manual-en/sdo-model-type.issequencedtype.html
    • /usr/share/doc/php-manual-en/sdo-sequence.getproperty.html
    • /usr/share/doc/php-manual-en/sdo-sequence.insert.html
    • /usr/share/doc/php-manual-en/sdo-sequence.move.html
    • /usr/share/doc/php-manual-en/sdo.configuration.html
    • /usr/share/doc/php-manual-en/sdo.constants.html
    • /usr/share/doc/php-manual-en/sdo.examples-basic.html
    • /usr/share/doc/php-manual-en/sdo.examples.html
    • /usr/share/doc/php-manual-en/sdo.installation.html
    • /usr/share/doc/php-manual-en/sdo.limitations.html
    • /usr/share/doc/php-manual-en/sdo.requirements.html
    • /usr/share/doc/php-manual-en/sdo.resources.html
    • /usr/share/doc/php-manual-en/sdo.sample.getset.html
    • /usr/share/doc/php-manual-en/sdo.sample.reflection.html
    • /usr/share/doc/php-manual-en/sdo.sample.sequence.html
    • /usr/share/doc/php-manual-en/sdo.setup.html
    • /usr/share/doc/php-manual-en/sdodasrel.configuration.html
    • /usr/share/doc/php-manual-en/sdodasrel.constants.html
    • /usr/share/doc/php-manual-en/sdodasrel.examples-crud.html
    • /usr/share/doc/php-manual-en/sdodasrel.examples.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sdodasrel.examples.three-table.html
    • /usr/share/doc/php-manual-en/sdodasrel.examples.two-table.html
    • /usr/share/doc/php-manual-en/sdodasrel.installation.html
    • /usr/share/doc/php-manual-en/sdodasrel.limitations.html
    • /usr/share/doc/php-manual-en/sdodasrel.metadata.html
    • /usr/share/doc/php-manual-en/sdodasrel.requirements.html
    • /usr/share/doc/php-manual-en/sdodasrel.resources.html
    • /usr/share/doc/php-manual-en/sdodasrel.setup.html
    • /usr/share/doc/php-manual-en/search-description.json
    • /usr/share/doc/php-manual-en/search-index.json
    • /usr/share/doc/php-manual-en/security.apache.html
    • /usr/share/doc/php-manual-en/security.cgi-bin.attacks.html
    • /usr/share/doc/php-manual-en/security.cgi-bin.default.html
    • /usr/share/doc/php-manual-en/security.cgi-bin.doc-root.html
    • /usr/share/doc/php-manual-en/security.cgi-bin.force-redirect.html
    • /usr/share/doc/php-manual-en/security.cgi-bin.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/security.current.html
    • /usr/share/doc/php-manual-en/security.database.connection.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/security.database.html
    • /usr/share/doc/php-manual-en/security.database.sql-injection.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/security.errors.html
    • /usr/share/doc/php-manual-en/security.filesystem.html
    • /usr/share/doc/php-manual-en/security.filesystem.nullbytes.html
    • /usr/share/doc/php-manual-en/security.general.html
    • /usr/share/doc/php-manual-en/security.globals.html
    • /usr/share/doc/php-manual-en/security.hiding.html
    • /usr/share/doc/php-manual-en/security.html
    • /usr/share/doc/php-manual-en/security.intro.html
    • /usr/share/doc/php-manual-en/security.magicquotes.disabling.html
    • /usr/share/doc/php-manual-en/security.magicquotes.html
    • /usr/share/doc/php-manual-en/security.magicquotes.what.html
    • /usr/share/doc/php-manual-en/security.magicquotes.why.html
    • /usr/share/doc/php-manual-en/security.magicquotes.whynot.html
    • /usr/share/doc/php-manual-en/security.variables.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sem.configuration.html
    • /usr/share/doc/php-manual-en/sem.constants.html
    • /usr/share/doc/php-manual-en/sem.installation.html
    • /usr/share/doc/php-manual-en/sem.requirements.html
    • /usr/share/doc/php-manual-en/sem.resources.html
    • /usr/share/doc/php-manual-en/sem.setup.html
    • /usr/share/doc/php-manual-en/serializable.serialize.html
    • /usr/share/doc/php-manual-en/serializable.unserialize.html
    • /usr/share/doc/php-manual-en/session-pgsql.configuration.html
    • /usr/share/doc/php-manual-en/session-pgsql.constants.html
    • /usr/share/doc/php-manual-en/session-pgsql.installation.html
    • /usr/share/doc/php-manual-en/session-pgsql.requirements.html
    • /usr/share/doc/php-manual-en/session-pgsql.resources.html
    • /usr/share/doc/php-manual-en/session-pgsql.setup.html
    • /usr/share/doc/php-manual-en/session-pgsql.tables.html
    • /usr/share/doc/php-manual-en/session.configuration.html
    • /usr/share/doc/php-manual-en/session.constants.html
    • /usr/share/doc/php-manual-en/session.customhandler.html
    • /usr/share/doc/php-manual-en/session.examples.basic.html
    • /usr/share/doc/php-manual-en/session.examples.html
    • /usr/share/doc/php-manual-en/session.idpassing.html
    • /usr/share/doc/php-manual-en/session.installation.html
    • /usr/share/doc/php-manual-en/session.requirements.html
    • /usr/share/doc/php-manual-en/session.resources.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/session.setup.html
    • /usr/share/doc/php-manual-en/session.upload-progress.html
    • /usr/share/doc/php-manual-en/sessionhandler.close.html
    • /usr/share/doc/php-manual-en/sessionhandler.destroy.html
    • /usr/share/doc/php-manual-en/sessionhandler.gc.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sessionhandler.write.html
    • /usr/share/doc/php-manual-en/sessionhandlerinterface.close.html
    • /usr/share/doc/php-manual-en/sessionhandlerinterface.destroy.html
    • /usr/share/doc/php-manual-en/sessionhandlerinterface.gc.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sessionhandlerinterface.write.html
    • /usr/share/doc/php-manual-en/set.mysqlinfo.html
    • /usr/share/doc/php-manual-en/shmop.configuration.html
    • /usr/share/doc/php-manual-en/shmop.constants.html
    • /usr/share/doc/php-manual-en/shmop.examples-basic.html
    • /usr/share/doc/php-manual-en/shmop.examples.html
    • /usr/share/doc/php-manual-en/shmop.installation.html
    • /usr/share/doc/php-manual-en/shmop.requirements.html
    • /usr/share/doc/php-manual-en/shmop.resources.html
    • /usr/share/doc/php-manual-en/shmop.setup.html
    • /usr/share/doc/php-manual-en/simplexml.configuration.html
    • /usr/share/doc/php-manual-en/simplexml.constants.html
    • /usr/share/doc/php-manual-en/simplexml.examples-basic.html
    • /usr/share/doc/php-manual-en/simplexml.examples-errors.html
    • /usr/share/doc/php-manual-en/simplexml.examples.html
    • /usr/share/doc/php-manual-en/simplexml.installation.html
    • /usr/share/doc/php-manual-en/simplexml.requirements.html
    • /usr/share/doc/php-manual-en/simplexml.resources.html
    • /usr/share/doc/php-manual-en/simplexml.setup.html
    • /usr/share/doc/php-manual-en/simplexmlelement.addattribute.html
    • /usr/share/doc/php-manual-en/simplexmlelement.addchild.html
    • /usr/share/doc/php-manual-en/simplexmlelement.asxml.html
    • /usr/share/doc/php-manual-en/simplexmlelement.attributes.html
    • /usr/share/doc/php-manual-en/simplexmlelement.children.html
    • /usr/share/doc/php-manual-en/simplexmlelement.construct.html
    • /usr/share/doc/php-manual-en/simplexmlelement.count.html
    • /usr/share/doc/php-manual-en/simplexmlelement.getdocnamespaces.html
    • /usr/share/doc/php-manual-en/simplexmlelement.getname.html
    • /usr/share/doc/php-manual-en/simplexmlelement.getnamespaces.html
    • /usr/share/doc/php-manual-en/simplexmlelement.registerxpathnamespace.html
    • /usr/share/doc/php-manual-en/simplexmlelement.savexml.html
    • /usr/share/doc/php-manual-en/simplexmlelement.tostring.html
    • /usr/share/doc/php-manual-en/simplexmlelement.xpath.html
    • /usr/share/doc/php-manual-en/simplexmliterator.current.html
    • /usr/share/doc/php-manual-en/simplexmliterator.getchildren.html
    • /usr/share/doc/php-manual-en/simplexmliterator.haschildren.html
    • /usr/share/doc/php-manual-en/simplexmliterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/simplexmliterator.rewind.html
    • /usr/share/doc/php-manual-en/simplexmliterator.valid.html
    • /usr/share/doc/php-manual-en/snmp.close.html
    • /usr/share/doc/php-manual-en/snmp.configuration.html
    • /usr/share/doc/php-manual-en/snmp.constants.html
    • /usr/share/doc/php-manual-en/snmp.construct.html
    • /usr/share/doc/php-manual-en/snmp.get.html
    • /usr/share/doc/php-manual-en/snmp.geterrno.html
    • /usr/share/doc/php-manual-en/snmp.geterror.html
    • /usr/share/doc/php-manual-en/snmp.getnext.html
    • /usr/share/doc/php-manual-en/snmp.installation.html
    • /usr/share/doc/php-manual-en/snmp.requirements.html
    • /usr/share/doc/php-manual-en/snmp.resources.html
    • /usr/share/doc/php-manual-en/snmp.set.html
    • /usr/share/doc/php-manual-en/snmp.setsecurity.html
    • /usr/share/doc/php-manual-en/snmp.setup.html
    • /usr/share/doc/php-manual-en/snmp.walk.html
    • /usr/share/doc/php-manual-en/soap.configuration.html
    • /usr/share/doc/php-manual-en/soap.constants.html
    • /usr/share/doc/php-manual-en/soap.installation.html
    • /usr/share/doc/php-manual-en/soap.requirements.html
    • /usr/share/doc/php-manual-en/soap.resources.html
    • /usr/share/doc/php-manual-en/soap.setup.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/soapclient.construct.html
    • /usr/share/doc/php-manual-en/soapclient.dorequest.html
    • /usr/share/doc/php-manual-en/soapclient.getfunctions.html
    • /usr/share/doc/php-manual-en/soapclient.getlastrequest.html
    • /usr/share/doc/php-manual-en/soapclient.getlastrequestheaders.html
    • /usr/share/doc/php-manual-en/soapclient.getlastresponse.html
    • /usr/share/doc/php-manual-en/soapclient.getlastresponseheaders.html
    • /usr/share/doc/php-manual-en/soapclient.gettypes.html
    • /usr/share/doc/php-manual-en/soapclient.setcookie.html
    • /usr/share/doc/php-manual-en/soapclient.setlocation.html
    • /usr/share/doc/php-manual-en/soapclient.setsoapheaders.html
    • /usr/share/doc/php-manual-en/soapclient.soapcall.html
    • /usr/share/doc/php-manual-en/soapclient.soapclient.html
    • /usr/share/doc/php-manual-en/soapfault.construct.html
    • /usr/share/doc/php-manual-en/soapfault.soapfault.html
    • /usr/share/doc/php-manual-en/soapfault.tostring.html
    • /usr/share/doc/php-manual-en/soapheader.construct.html
    • /usr/share/doc/php-manual-en/soapheader.soapheader.html
    • /usr/share/doc/php-manual-en/soapparam.construct.html
    • /usr/share/doc/php-manual-en/soapparam.soapparam.html
    • /usr/share/doc/php-manual-en/soapserver.addfunction.html
    • /usr/share/doc/php-manual-en/soapserver.addsoapheader.html
    • /usr/share/doc/php-manual-en/soapserver.construct.html
    • /usr/share/doc/php-manual-en/soapserver.fault.html
    • /usr/share/doc/php-manual-en/soapserver.getfunctions.html
    • /usr/share/doc/php-manual-en/soapserver.handle.html
    • /usr/share/doc/php-manual-en/soapserver.setclass.html
    • /usr/share/doc/php-manual-en/soapserver.setobject.html
    • /usr/share/doc/php-manual-en/soapserver.setpersistence.html
    • /usr/share/doc/php-manual-en/soapserver.soapserver.html
    • /usr/share/doc/php-manual-en/soapvar.construct.html
    • /usr/share/doc/php-manual-en/soapvar.soapvar.html
    • /usr/share/doc/php-manual-en/sockets.configuration.html
    • /usr/share/doc/php-manual-en/sockets.constants.html
    • /usr/share/doc/php-manual-en/sockets.errors.html
    • /usr/share/doc/php-manual-en/sockets.examples.html
    • /usr/share/doc/php-manual-en/sockets.installation.html
    • /usr/share/doc/php-manual-en/sockets.requirements.html
    • /usr/share/doc/php-manual-en/sockets.resources.html
    • /usr/share/doc/php-manual-en/sockets.setup.html
    • /usr/share/doc/php-manual-en/solr.configuration.html
    • /usr/share/doc/php-manual-en/solr.constants.html
    • /usr/share/doc/php-manual-en/solr.examples.html
    • /usr/share/doc/php-manual-en/solr.installation.html
    • /usr/share/doc/php-manual-en/solr.requirements.html
    • /usr/share/doc/php-manual-en/solr.resources.html
    • /usr/share/doc/php-manual-en/solr.setup.html
    • /usr/share/doc/php-manual-en/solrclient.adddocument.html
    • /usr/share/doc/php-manual-en/solrclient.adddocuments.html
    • /usr/share/doc/php-manual-en/solrclient.commit.html
    • /usr/share/doc/php-manual-en/solrclient.construct.html
    • /usr/share/doc/php-manual-en/solrclient.deletebyid.html
    • /usr/share/doc/php-manual-en/solrclient.deletebyids.html
    • /usr/share/doc/php-manual-en/solrclient.deletebyqueries.html
    • /usr/share/doc/php-manual-en/solrclient.deletebyquery.html
    • /usr/share/doc/php-manual-en/solrclient.destruct.html
    • /usr/share/doc/php-manual-en/solrclient.getdebug.html
    • /usr/share/doc/php-manual-en/solrclient.getoptions.html
    • /usr/share/doc/php-manual-en/solrclient.optimize.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/solrclient.query.html
    • /usr/share/doc/php-manual-en/solrclient.request.html
    • /usr/share/doc/php-manual-en/solrclient.rollback.html
    • /usr/share/doc/php-manual-en/solrclient.setresponsewriter.html
    • /usr/share/doc/php-manual-en/solrclient.setservlet.html
    • /usr/share/doc/php-manual-en/solrclient.threads.html
    • /usr/share/doc/php-manual-en/solrclientexception.getinternalinfo.html
    • /usr/share/doc/php-manual-en/solrdocument.addfield.html
    • /usr/share/doc/php-manual-en/solrdocument.clear.html
    • /usr/share/doc/php-manual-en/solrdocument.clone.html
    • /usr/share/doc/php-manual-en/solrdocument.construct.html
    • /usr/share/doc/php-manual-en/solrdocument.current.html
    • /usr/share/doc/php-manual-en/solrdocument.deletefield.html
    • /usr/share/doc/php-manual-en/solrdocument.destruct.html
    • /usr/share/doc/php-manual-en/solrdocument.fieldexists.html
    • /usr/share/doc/php-manual-en/solrdocument.get.html
    • /usr/share/doc/php-manual-en/solrdocument.getfield.html
    • /usr/share/doc/php-manual-en/solrdocument.getfieldcount.html
    • /usr/share/doc/php-manual-en/solrdocument.getfieldnames.html
    • /usr/share/doc/php-manual-en/solrdocument.getinputdocument.html
    • /usr/share/doc/php-manual-en/solrdocument.isset.html
    • /usr/share/doc/php-manual-en/solrdocument.key.html
    • /usr/share/doc/php-manual-en/solrdocument.merge.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/solrdocument.offsetexists.html
    • /usr/share/doc/php-manual-en/solrdocument.offsetget.html
    • /usr/share/doc/php-manual-en/solrdocument.offsetset.html
    • /usr/share/doc/php-manual-en/solrdocument.offsetunset.html
    • /usr/share/doc/php-manual-en/solrdocument.reset.html
    • /usr/share/doc/php-manual-en/solrdocument.rewind.html
    • /usr/share/doc/php-manual-en/solrdocument.serialize.html
    • /usr/share/doc/php-manual-en/solrdocument.set.html
    • /usr/share/doc/php-manual-en/solrdocument.sort.html
    • /usr/share/doc/php-manual-en/solrdocument.toarray.html
    • /usr/share/doc/php-manual-en/solrdocument.unserialize.html
    • /usr/share/doc/php-manual-en/solrdocument.unset.html
    • /usr/share/doc/php-manual-en/solrdocument.valid.html
    • /usr/share/doc/php-manual-en/solrdocumentfield.construct.html
    • /usr/share/doc/php-manual-en/solrdocumentfield.destruct.html
    • /usr/share/doc/php-manual-en/solrexception.getinternalinfo.html
    • /usr/share/doc/php-manual-en/solrgenericresponse.construct.html
    • /usr/share/doc/php-manual-en/solrgenericresponse.destruct.html
    • /usr/share/doc/php-manual-en/solrillegalargumentexception.getinternalinfo.html
    • /usr/share/doc/php-manual-en/solrillegaloperationexception.getinternalinfo.html
    • /usr/share/doc/php-manual-en/solrinputdocument.addfield.html
    • /usr/share/doc/php-manual-en/solrinputdocument.clear.html
    • /usr/share/doc/php-manual-en/solrinputdocument.clone.html
    • /usr/share/doc/php-manual-en/solrinputdocument.construct.html
    • /usr/share/doc/php-manual-en/solrinputdocument.deletefield.html
    • /usr/share/doc/php-manual-en/solrinputdocument.destruct.html
    • /usr/share/doc/php-manual-en/solrinputdocument.fieldexists.html
    • /usr/share/doc/php-manual-en/solrinputdocument.getboost.html
    • /usr/share/doc/php-manual-en/solrinputdocument.getfield.html
    • /usr/share/doc/php-manual-en/solrinputdocument.getfieldboost.html
    • /usr/share/doc/php-manual-en/solrinputdocument.getfieldcount.html
    • /usr/share/doc/php-manual-en/solrinputdocument.getfieldnames.html
    • /usr/share/doc/php-manual-en/solrinputdocument.merge.html
    • /usr/share/doc/php-manual-en/solrinputdocument.reset.html
    • /usr/share/doc/php-manual-en/solrinputdocument.setboost.html
    • /usr/share/doc/php-manual-en/solrinputdocument.setfieldboost.html
    • /usr/share/doc/php-manual-en/solrinputdocument.sort.html
    • /usr/share/doc/php-manual-en/solrinputdocument.toarray.html
    • /usr/share/doc/php-manual-en/solrmodifiableparams.construct.html
    • /usr/share/doc/php-manual-en/solrmodifiableparams.destruct.html
    • /usr/share/doc/php-manual-en/solrobject.construct.html
    • /usr/share/doc/php-manual-en/solrobject.destruct.html
    • /usr/share/doc/php-manual-en/solrobject.getpropertynames.html
    • /usr/share/doc/php-manual-en/solrobject.offsetexists.html
    • /usr/share/doc/php-manual-en/solrobject.offsetget.html
    • /usr/share/doc/php-manual-en/solrobject.offsetset.html
    • /usr/share/doc/php-manual-en/solrobject.offsetunset.html
    • /usr/share/doc/php-manual-en/solrparams.add.html
    • /usr/share/doc/php-manual-en/solrparams.addparam.html
    • /usr/share/doc/php-manual-en/solrparams.get.html
    • /usr/share/doc/php-manual-en/solrparams.getparam.html
    • /usr/share/doc/php-manual-en/solrparams.getparams.html
    • /usr/share/doc/php-manual-en/solrparams.getpreparedparams.html
    • /usr/share/doc/php-manual-en/solrparams.serialize.html
    • /usr/share/doc/php-manual-en/solrparams.set.html
    • /usr/share/doc/php-manual-en/solrparams.setparam.html
    • /usr/share/doc/php-manual-en/solrparams.tostring.html
    • /usr/share/doc/php-manual-en/solrparams.unserialize.html
    • /usr/share/doc/php-manual-en/solrpingresponse.construct.html
    • /usr/share/doc/php-manual-en/solrpingresponse.destruct.html
    • /usr/share/doc/php-manual-en/solrpingresponse.getresponse.html
    • /usr/share/doc/php-manual-en/solrquery.addfacetdatefield.html
    • /usr/share/doc/php-manual-en/solrquery.addfacetdateother.html
    • /usr/share/doc/php-manual-en/solrquery.addfacetfield.html
    • /usr/share/doc/php-manual-en/solrquery.addfacetquery.html
    • /usr/share/doc/php-manual-en/solrquery.addfield.html
    • /usr/share/doc/php-manual-en/solrquery.addfilterquery.html
    • /usr/share/doc/php-manual-en/solrquery.addhighlightfield.html
    • /usr/share/doc/php-manual-en/solrquery.addmltfield.html
    • /usr/share/doc/php-manual-en/solrquery.addmltqueryfield.html
    • /usr/share/doc/php-manual-en/solrquery.addsortfield.html
    • /usr/share/doc/php-manual-en/solrquery.addstatsfacet.html
    • /usr/share/doc/php-manual-en/solrquery.addstatsfield.html
    • /usr/share/doc/php-manual-en/solrquery.construct.html
    • /usr/share/doc/php-manual-en/solrquery.destruct.html
    • /usr/share/doc/php-manual-en/solrquery.getfacet.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdateend.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdatefields.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdategap.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdatehardend.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdateother.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetdatestart.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetfields.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetlimit.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetmethod.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetmincount.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetmissing.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetoffset.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetprefix.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetqueries.html
    • /usr/share/doc/php-manual-en/solrquery.getfacetsort.html
    • /usr/share/doc/php-manual-en/solrquery.getfields.html
    • /usr/share/doc/php-manual-en/solrquery.getfilterqueries.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlight.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightalternatefield.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightfields.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightformatter.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightfragmenter.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightfragsize.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlighthighlightmultiterm.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightmaxalternatefieldlength.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightmaxanalyzedchars.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightmergecontiguous.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightregexmaxanalyzedchars.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightregexpattern.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightregexslop.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightrequirefieldmatch.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightsimplepost.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightsimplepre.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightsnippets.html
    • /usr/share/doc/php-manual-en/solrquery.gethighlightusephrasehighlighter.html
    • /usr/share/doc/php-manual-en/solrquery.getmlt.html
    • /usr/share/doc/php-manual-en/solrquery.getmltboost.html
    • /usr/share/doc/php-manual-en/solrquery.getmltcount.html
    • /usr/share/doc/php-manual-en/solrquery.getmltfields.html
    • /usr/share/doc/php-manual-en/solrquery.getmltmaxnumqueryterms.html
    • /usr/share/doc/php-manual-en/solrquery.getmltmaxnumtokens.html
    • /usr/share/doc/php-manual-en/solrquery.getmltmaxwordlength.html
    • /usr/share/doc/php-manual-en/solrquery.getmltmindocfrequency.html
    • /usr/share/doc/php-manual-en/solrquery.getmltmintermfrequency.html
    • /usr/share/doc/php-manual-en/solrquery.getmltminwordlength.html
    • /usr/share/doc/php-manual-en/solrquery.getmltqueryfields.html
    • /usr/share/doc/php-manual-en/solrquery.getquery.html
    • /usr/share/doc/php-manual-en/solrquery.getrows.html
    • /usr/share/doc/php-manual-en/solrquery.getsortfields.html
    • /usr/share/doc/php-manual-en/solrquery.getstart.html
    • /usr/share/doc/php-manual-en/solrquery.getstats.html
    • /usr/share/doc/php-manual-en/solrquery.getstatsfacets.html
    • /usr/share/doc/php-manual-en/solrquery.getstatsfields.html
    • /usr/share/doc/php-manual-en/solrquery.getterms.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsfield.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsincludelowerbound.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsincludeupperbound.html
    • /usr/share/doc/php-manual-en/solrquery.gettermslimit.html
    • /usr/share/doc/php-manual-en/solrquery.gettermslowerbound.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsmaxcount.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsmincount.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsprefix.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsreturnraw.html
    • /usr/share/doc/php-manual-en/solrquery.gettermssort.html
    • /usr/share/doc/php-manual-en/solrquery.gettermsupperbound.html
    • /usr/share/doc/php-manual-en/solrquery.gettimeallowed.html
    • /usr/share/doc/php-manual-en/solrquery.removefacetdatefield.html
    • /usr/share/doc/php-manual-en/solrquery.removefacetdateother.html
    • /usr/share/doc/php-manual-en/solrquery.removefacetfield.html
    • /usr/share/doc/php-manual-en/solrquery.removefacetquery.html
    • /usr/share/doc/php-manual-en/solrquery.removefield.html
    • /usr/share/doc/php-manual-en/solrquery.removefilterquery.html
    • /usr/share/doc/php-manual-en/solrquery.removehighlightfield.html
    • /usr/share/doc/php-manual-en/solrquery.removemltfield.html
    • /usr/share/doc/php-manual-en/solrquery.removemltqueryfield.html
    • /usr/share/doc/php-manual-en/solrquery.removesortfield.html
    • /usr/share/doc/php-manual-en/solrquery.removestatsfacet.html
    • /usr/share/doc/php-manual-en/solrquery.removestatsfield.html
    • /usr/share/doc/php-manual-en/solrquery.setechohandler.html
    • /usr/share/doc/php-manual-en/solrquery.setechoparams.html
    • /usr/share/doc/php-manual-en/solrquery.setexplainother.html
    • /usr/share/doc/php-manual-en/solrquery.setfacet.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetdateend.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetdategap.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetdatehardend.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetdatestart.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetenumcachemindefaultfrequency.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetlimit.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetmethod.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetmincount.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetmissing.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetoffset.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetprefix.html
    • /usr/share/doc/php-manual-en/solrquery.setfacetsort.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlight.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightalternatefield.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightformatter.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightfragmenter.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightfragsize.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlighthighlightmultiterm.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightmaxalternatefieldlength.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightmaxanalyzedchars.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightmergecontiguous.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightregexmaxanalyzedchars.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightregexpattern.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightregexslop.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightrequirefieldmatch.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightsimplepost.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightsimplepre.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightsnippets.html
    • /usr/share/doc/php-manual-en/solrquery.sethighlightusephrasehighlighter.html
    • /usr/share/doc/php-manual-en/solrquery.setmlt.html
    • /usr/share/doc/php-manual-en/solrquery.setmltboost.html
    • /usr/share/doc/php-manual-en/solrquery.setmltcount.html
    • /usr/share/doc/php-manual-en/solrquery.setmltmaxnumqueryterms.html
    • /usr/share/doc/php-manual-en/solrquery.setmltmaxnumtokens.html
    • /usr/share/doc/php-manual-en/solrquery.setmltmaxwordlength.html
    • /usr/share/doc/php-manual-en/solrquery.setmltmindocfrequency.html
    • /usr/share/doc/php-manual-en/solrquery.setmltmintermfrequency.html
    • /usr/share/doc/php-manual-en/solrquery.setmltminwordlength.html
    • /usr/share/doc/php-manual-en/solrquery.setomitheader.html
    • /usr/share/doc/php-manual-en/solrquery.setquery.html
    • /usr/share/doc/php-manual-en/solrquery.setrows.html
    • /usr/share/doc/php-manual-en/solrquery.setshowdebuginfo.html
    • /usr/share/doc/php-manual-en/solrquery.setstart.html
    • /usr/share/doc/php-manual-en/solrquery.setstats.html
    • /usr/share/doc/php-manual-en/solrquery.setterms.html
    • /usr/share/doc/php-manual-en/solrquery.settermsfield.html
    • /usr/share/doc/php-manual-en/solrquery.settermsincludelowerbound.html
    • /usr/share/doc/php-manual-en/solrquery.settermsincludeupperbound.html
    • /usr/share/doc/php-manual-en/solrquery.settermslimit.html
    • /usr/share/doc/php-manual-en/solrquery.settermslowerbound.html
    • /usr/share/doc/php-manual-en/solrquery.settermsmaxcount.html
    • /usr/share/doc/php-manual-en/solrquery.settermsmincount.html
    • /usr/share/doc/php-manual-en/solrquery.settermsprefix.html
    • /usr/share/doc/php-manual-en/solrquery.settermsreturnraw.html
    • /usr/share/doc/php-manual-en/solrquery.settermssort.html
    • /usr/share/doc/php-manual-en/solrquery.settermsupperbound.html
    • /usr/share/doc/php-manual-en/solrquery.settimeallowed.html
    • /usr/share/doc/php-manual-en/solrqueryresponse.construct.html
    • /usr/share/doc/php-manual-en/solrqueryresponse.destruct.html
    • /usr/share/doc/php-manual-en/solrresponse.getdigestedresponse.html
    • /usr/share/doc/php-manual-en/solrresponse.gethttpstatus.html
    • /usr/share/doc/php-manual-en/solrresponse.gethttpstatusmessage.html
    • /usr/share/doc/php-manual-en/solrresponse.getrawrequest.html
    • /usr/share/doc/php-manual-en/solrresponse.getrawrequestheaders.html
    • /usr/share/doc/php-manual-en/solrresponse.getrawresponse.html
    • /usr/share/doc/php-manual-en/solrresponse.getrawresponseheaders.html
    • /usr/share/doc/php-manual-en/solrresponse.getrequesturl.html
    • /usr/share/doc/php-manual-en/solrresponse.getresponse.html
    • /usr/share/doc/php-manual-en/solrresponse.setparsemode.html
    • /usr/share/doc/php-manual-en/solrresponse.success.html
    • /usr/share/doc/php-manual-en/solrupdateresponse.construct.html
    • /usr/share/doc/php-manual-en/solrupdateresponse.destruct.html
    • /usr/share/doc/php-manual-en/solrutils.digestxmlresponse.html
    • /usr/share/doc/php-manual-en/solrutils.escapequerychars.html
    • /usr/share/doc/php-manual-en/solrutils.getsolrversion.html
    • /usr/share/doc/php-manual-en/solrutils.queryphrase.html
    • /usr/share/doc/php-manual-en/sphinx.configuration.html
    • /usr/share/doc/php-manual-en/sphinx.constants.html
    • /usr/share/doc/php-manual-en/sphinx.examples.html
    • /usr/share/doc/php-manual-en/sphinx.installation.html
    • /usr/share/doc/php-manual-en/sphinx.requirements.html
    • /usr/share/doc/php-manual-en/sphinx.resources.html
    • /usr/share/doc/php-manual-en/sphinx.setup.html
    • /usr/share/doc/php-manual-en/sphinxclient.addquery.html
    • /usr/share/doc/php-manual-en/sphinxclient.buildexcerpts.html
    • /usr/share/doc/php-manual-en/sphinxclient.buildkeywords.html
    • /usr/share/doc/php-manual-en/sphinxclient.close.html
    • /usr/share/doc/php-manual-en/sphinxclient.construct.html
    • /usr/share/doc/php-manual-en/sphinxclient.escapestring.html
    • /usr/share/doc/php-manual-en/sphinxclient.getlasterror.html
    • /usr/share/doc/php-manual-en/sphinxclient.getlastwarning.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sphinxclient.query.html
    • /usr/share/doc/php-manual-en/sphinxclient.resetfilters.html
    • /usr/share/doc/php-manual-en/sphinxclient.resetgroupby.html
    • /usr/share/doc/php-manual-en/sphinxclient.runqueries.html
    • /usr/share/doc/php-manual-en/sphinxclient.setarrayresult.html
    • /usr/share/doc/php-manual-en/sphinxclient.setconnecttimeout.html
    • /usr/share/doc/php-manual-en/sphinxclient.setfieldweights.html
    • /usr/share/doc/php-manual-en/sphinxclient.setfilter.html
    • /usr/share/doc/php-manual-en/sphinxclient.setfilterfloatrange.html
    • /usr/share/doc/php-manual-en/sphinxclient.setfilterrange.html
    • /usr/share/doc/php-manual-en/sphinxclient.setgeoanchor.html
    • /usr/share/doc/php-manual-en/sphinxclient.setgroupby.html
    • /usr/share/doc/php-manual-en/sphinxclient.setgroupdistinct.html
    • /usr/share/doc/php-manual-en/sphinxclient.setidrange.html
    • /usr/share/doc/php-manual-en/sphinxclient.setindexweights.html
    • /usr/share/doc/php-manual-en/sphinxclient.setlimits.html
    • /usr/share/doc/php-manual-en/sphinxclient.setmatchmode.html
    • /usr/share/doc/php-manual-en/sphinxclient.setmaxquerytime.html
    • /usr/share/doc/php-manual-en/sphinxclient.setoverride.html
    • /usr/share/doc/php-manual-en/sphinxclient.setrankingmode.html
    • /usr/share/doc/php-manual-en/sphinxclient.setretries.html
    • /usr/share/doc/php-manual-en/sphinxclient.setselect.html
    • /usr/share/doc/php-manual-en/sphinxclient.setserver.html
    • /usr/share/doc/php-manual-en/sphinxclient.setsortmode.html
    • /usr/share/doc/php-manual-en/sphinxclient.status.html
    • /usr/share/doc/php-manual-en/sphinxclient.updateattributes.html
    • /usr/share/doc/php-manual-en/spl-types.configuration.html
    • /usr/share/doc/php-manual-en/spl-types.installation.html
    • /usr/share/doc/php-manual-en/spl-types.requirements.html
    • /usr/share/doc/php-manual-en/spl-types.resources.html
    • /usr/share/doc/php-manual-en/spl-types.setup.html
    • /usr/share/doc/php-manual-en/spl.configuration.html
    • /usr/share/doc/php-manual-en/spl.constants.html
    • /usr/share/doc/php-manual-en/spl.datastructures.html
    • /usr/share/doc/php-manual-en/spl.exceptions.html
    • /usr/share/doc/php-manual-en/spl.files.html
    • /usr/share/doc/php-manual-en/spl.installation.html
    • /usr/share/doc/php-manual-en/spl.interfaces.html
    • /usr/share/doc/php-manual-en/spl.iterators.html
    • /usr/share/doc/php-manual-en/spl.misc.html
    • /usr/share/doc/php-manual-en/spl.requirements.html
    • /usr/share/doc/php-manual-en/spl.resources.html
    • /usr/share/doc/php-manual-en/spl.setup.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.bottom.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.construct.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.count.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.current.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.getiteratormode.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.isempty.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.offsetexists.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.offsetget.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.offsetset.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.offsetunset.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.pop.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.prev.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.push.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.rewind.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.serialize.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.setiteratormode.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.shift.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.unserialize.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.unshift.html
    • /usr/share/doc/php-manual-en/spldoublylinkedlist.valid.html
    • /usr/share/doc/php-manual-en/splenum.getconstlist.html
    • /usr/share/doc/php-manual-en/splfileinfo.construct.html
    • /usr/share/doc/php-manual-en/splfileinfo.getatime.html
    • /usr/share/doc/php-manual-en/splfileinfo.getbasename.html
    • /usr/share/doc/php-manual-en/splfileinfo.getctime.html
    • /usr/share/doc/php-manual-en/splfileinfo.getextension.html
    • /usr/share/doc/php-manual-en/splfileinfo.getfileinfo.html
    • /usr/share/doc/php-manual-en/splfileinfo.getfilename.html
    • /usr/share/doc/php-manual-en/splfileinfo.getgroup.html
    • /usr/share/doc/php-manual-en/splfileinfo.getinode.html
    • /usr/share/doc/php-manual-en/splfileinfo.getlinktarget.html
    • /usr/share/doc/php-manual-en/splfileinfo.getmtime.html
    • /usr/share/doc/php-manual-en/splfileinfo.getowner.html
    • /usr/share/doc/php-manual-en/splfileinfo.getpath.html
    • /usr/share/doc/php-manual-en/splfileinfo.getpathinfo.html
    • /usr/share/doc/php-manual-en/splfileinfo.getpathname.html
    • /usr/share/doc/php-manual-en/splfileinfo.getperms.html
    • /usr/share/doc/php-manual-en/splfileinfo.getrealpath.html
    • /usr/share/doc/php-manual-en/splfileinfo.getsize.html
    • /usr/share/doc/php-manual-en/splfileinfo.gettype.html
    • /usr/share/doc/php-manual-en/splfileinfo.isdir.html
    • /usr/share/doc/php-manual-en/splfileinfo.isexecutable.html
    • /usr/share/doc/php-manual-en/splfileinfo.isfile.html
    • /usr/share/doc/php-manual-en/splfileinfo.islink.html
    • /usr/share/doc/php-manual-en/splfileinfo.isreadable.html
    • /usr/share/doc/php-manual-en/splfileinfo.iswritable.html
    • /usr/share/doc/php-manual-en/splfileinfo.openfile.html
    • /usr/share/doc/php-manual-en/splfileinfo.setfileclass.html
    • /usr/share/doc/php-manual-en/splfileinfo.setinfoclass.html
    • /usr/share/doc/php-manual-en/splfileinfo.tostring.html
    • /usr/share/doc/php-manual-en/splfileobject.construct.html
    • /usr/share/doc/php-manual-en/splfileobject.current.html
    • /usr/share/doc/php-manual-en/splfileobject.eof.html
    • /usr/share/doc/php-manual-en/splfileobject.fflush.html
    • /usr/share/doc/php-manual-en/splfileobject.fgetc.html
    • /usr/share/doc/php-manual-en/splfileobject.fgetcsv.html
    • /usr/share/doc/php-manual-en/splfileobject.fgets.html
    • /usr/share/doc/php-manual-en/splfileobject.fgetss.html
    • /usr/share/doc/php-manual-en/splfileobject.flock.html
    • /usr/share/doc/php-manual-en/splfileobject.fpassthru.html
    • /usr/share/doc/php-manual-en/splfileobject.fputcsv.html
    • /usr/share/doc/php-manual-en/splfileobject.fscanf.html
    • /usr/share/doc/php-manual-en/splfileobject.fseek.html
    • /usr/share/doc/php-manual-en/splfileobject.fstat.html
    • /usr/share/doc/php-manual-en/splfileobject.ftell.html
    • /usr/share/doc/php-manual-en/splfileobject.ftruncate.html
    • /usr/share/doc/php-manual-en/splfileobject.fwrite.html
    • /usr/share/doc/php-manual-en/splfileobject.getchildren.html
    • /usr/share/doc/php-manual-en/splfileobject.getcsvcontrol.html
    • /usr/share/doc/php-manual-en/splfileobject.getcurrentline.html
    • /usr/share/doc/php-manual-en/splfileobject.getflags.html
    • /usr/share/doc/php-manual-en/splfileobject.getmaxlinelen.html
    • /usr/share/doc/php-manual-en/splfileobject.haschildren.html
    • /usr/share/doc/php-manual-en/splfileobject.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splfileobject.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splfileobject.setcsvcontrol.html
    • /usr/share/doc/php-manual-en/splfileobject.setflags.html
    • /usr/share/doc/php-manual-en/splfileobject.setmaxlinelen.html
    • /usr/share/doc/php-manual-en/splfileobject.tostring.html
    • /usr/share/doc/php-manual-en/splfileobject.valid.html
    • /usr/share/doc/php-manual-en/splfixedarray.construct.html
    • /usr/share/doc/php-manual-en/splfixedarray.count.html
    • /usr/share/doc/php-manual-en/splfixedarray.current.html
    • /usr/share/doc/php-manual-en/splfixedarray.fromarray.html
    • /usr/share/doc/php-manual-en/splfixedarray.getsize.html
    • /usr/share/doc/php-manual-en/splfixedarray.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splfixedarray.offsetexists.html
    • /usr/share/doc/php-manual-en/splfixedarray.offsetget.html
    • /usr/share/doc/php-manual-en/splfixedarray.offsetset.html
    • /usr/share/doc/php-manual-en/splfixedarray.offsetunset.html
    • /usr/share/doc/php-manual-en/splfixedarray.rewind.html
    • /usr/share/doc/php-manual-en/splfixedarray.setsize.html
    • /usr/share/doc/php-manual-en/splfixedarray.toarray.html
    • /usr/share/doc/php-manual-en/splfixedarray.valid.html
    • /usr/share/doc/php-manual-en/splfixedarray.wakeup.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splheap.construct.html
    • /usr/share/doc/php-manual-en/splheap.count.html
    • /usr/share/doc/php-manual-en/splheap.current.html
    • /usr/share/doc/php-manual-en/splheap.extract.html
    • /usr/share/doc/php-manual-en/splheap.insert.html
    • /usr/share/doc/php-manual-en/splheap.isempty.html
    • /usr/share/doc/php-manual-en/splheap.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splheap.recoverfromcorruption.html
    • /usr/share/doc/php-manual-en/splheap.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splheap.valid.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splobjectstorage.addall.html
    • /usr/share/doc/php-manual-en/splobjectstorage.attach.html
    • /usr/share/doc/php-manual-en/splobjectstorage.contains.html
    • /usr/share/doc/php-manual-en/splobjectstorage.count.html
    • /usr/share/doc/php-manual-en/splobjectstorage.current.html
    • /usr/share/doc/php-manual-en/splobjectstorage.detach.html
    • /usr/share/doc/php-manual-en/splobjectstorage.gethash.html
    • /usr/share/doc/php-manual-en/splobjectstorage.getinfo.html
    • /usr/share/doc/php-manual-en/splobjectstorage.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splobjectstorage.offsetexists.html
    • /usr/share/doc/php-manual-en/splobjectstorage.offsetget.html
    • /usr/share/doc/php-manual-en/splobjectstorage.offsetset.html
    • /usr/share/doc/php-manual-en/splobjectstorage.offsetunset.html
    • /usr/share/doc/php-manual-en/splobjectstorage.removeall.html
    • /usr/share/doc/php-manual-en/splobjectstorage.removeallexcept.html
    • /usr/share/doc/php-manual-en/splobjectstorage.rewind.html
    • /usr/share/doc/php-manual-en/splobjectstorage.serialize.html
    • /usr/share/doc/php-manual-en/splobjectstorage.setinfo.html
    • /usr/share/doc/php-manual-en/splobjectstorage.unserialize.html
    • /usr/share/doc/php-manual-en/splobjectstorage.valid.html
    • /usr/share/doc/php-manual-en/splobserver.update.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splpriorityqueue.construct.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.count.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.current.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.extract.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.insert.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.isempty.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splpriorityqueue.recoverfromcorruption.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.rewind.html
    • /usr/share/doc/php-manual-en/splpriorityqueue.setextractflags.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/splpriorityqueue.valid.html
    • /usr/share/doc/php-manual-en/splqueue.construct.html
    • /usr/share/doc/php-manual-en/splqueue.dequeue.html
    • /usr/share/doc/php-manual-en/splqueue.enqueue.html
    • /usr/share/doc/php-manual-en/splqueue.setiteratormode.html
    • /usr/share/doc/php-manual-en/splstack.construct.html
    • /usr/share/doc/php-manual-en/splstack.setiteratormode.html
    • /usr/share/doc/php-manual-en/splsubject.attach.html
    • /usr/share/doc/php-manual-en/splsubject.detach.html
    • /usr/share/doc/php-manual-en/splsubject.notify.html
    • /usr/share/doc/php-manual-en/spltempfileobject.construct.html
    • /usr/share/doc/php-manual-en/spltype.construct.html
    • /usr/share/doc/php-manual-en/spoofchecker.areconfusable.html
    • /usr/share/doc/php-manual-en/spoofchecker.construct.html
    • /usr/share/doc/php-manual-en/spoofchecker.issuspicious.html
    • /usr/share/doc/php-manual-en/spoofchecker.setallowedlocales.html
    • /usr/share/doc/php-manual-en/spoofchecker.setchecks.html
    • /usr/share/doc/php-manual-en/spplus.configuration.html
    • /usr/share/doc/php-manual-en/spplus.constants.html
    • /usr/share/doc/php-manual-en/spplus.installation.html
    • /usr/share/doc/php-manual-en/spplus.requirements.html
    • /usr/share/doc/php-manual-en/spplus.resources.html
    • /usr/share/doc/php-manual-en/spplus.setup.html
    • /usr/share/doc/php-manual-en/sqlite.configuration.html
    • /usr/share/doc/php-manual-en/sqlite.constants.html
    • /usr/share/doc/php-manual-en/sqlite.installation.html
    • /usr/share/doc/php-manual-en/sqlite.requirements.html
    • /usr/share/doc/php-manual-en/sqlite.resources.html
    • /usr/share/doc/php-manual-en/sqlite.setup.html
    • /usr/share/doc/php-manual-en/sqlite3.busytimeout.html
    • /usr/share/doc/php-manual-en/sqlite3.changes.html
    • /usr/share/doc/php-manual-en/sqlite3.close.html
    • /usr/share/doc/php-manual-en/sqlite3.configuration.html
    • /usr/share/doc/php-manual-en/sqlite3.constants.html
    • /usr/share/doc/php-manual-en/sqlite3.construct.html
    • /usr/share/doc/php-manual-en/sqlite3.createaggregate.html
    • /usr/share/doc/php-manual-en/sqlite3.createcollation.html
    • /usr/share/doc/php-manual-en/sqlite3.createfunction.html
    • /usr/share/doc/php-manual-en/sqlite3.escapestring.html
    • /usr/share/doc/php-manual-en/sqlite3.exec.html
    • /usr/share/doc/php-manual-en/sqlite3.installation.html
    • /usr/share/doc/php-manual-en/sqlite3.lasterrorcode.html
    • /usr/share/doc/php-manual-en/sqlite3.lasterrormsg.html
    • /usr/share/doc/php-manual-en/sqlite3.lastinsertrowid.html
    • /usr/share/doc/php-manual-en/sqlite3.loadextension.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/sqlite3.prepare.html
    • /usr/share/doc/php-manual-en/sqlite3.query.html
    • /usr/share/doc/php-manual-en/sqlite3.querysingle.html
    • /usr/share/doc/php-manual-en/sqlite3.requirements.html
    • /usr/share/doc/php-manual-en/sqlite3.resources.html
    • /usr/share/doc/php-manual-en/sqlite3.setup.html
    • /usr/share/doc/php-manual-en/sqlite3.version.html
    • /usr/share/doc/php-manual-en/sqlite3result.columnname.html
    • /usr/share/doc/php-manual-en/sqlite3result.columntype.html
    • /usr/share/doc/php-manual-en/sqlite3result.fetcharray.html
    • /usr/share/doc/php-manual-en/sqlite3result.finalize.html
    • /usr/share/doc/php-manual-en/sqlite3result.numcolumns.html
    • /usr/share/doc/php-manual-en/sqlite3result.reset.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.bindparam.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.bindvalue.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.clear.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.close.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.execute.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.paramcount.html
    • /usr/share/doc/php-manual-en/sqlite3stmt.reset.html
    • /usr/share/doc/php-manual-en/sqlsrv.configuration.html
    • /usr/share/doc/php-manual-en/sqlsrv.constants.html
    • /usr/share/doc/php-manual-en/sqlsrv.installation.html
    • /usr/share/doc/php-manual-en/sqlsrv.requirements.html
    • /usr/share/doc/php-manual-en/sqlsrv.resources.html
    • /usr/share/doc/php-manual-en/sqlsrv.setup.html
    • /usr/share/doc/php-manual-en/ssdeep.configuration.html
    • /usr/share/doc/php-manual-en/ssdeep.constants.html
    • /usr/share/doc/php-manual-en/ssdeep.installation.html
    • /usr/share/doc/php-manual-en/ssdeep.requirements.html
    • /usr/share/doc/php-manual-en/ssdeep.resources.html
    • /usr/share/doc/php-manual-en/ssdeep.setup.html
    • /usr/share/doc/php-manual-en/ssh2.configuration.html
    • /usr/share/doc/php-manual-en/ssh2.constants.html
    • /usr/share/doc/php-manual-en/ssh2.installation.html
    • /usr/share/doc/php-manual-en/ssh2.requirements.html
    • /usr/share/doc/php-manual-en/ssh2.resources.html
    • /usr/share/doc/php-manual-en/ssh2.setup.html
    • /usr/share/doc/php-manual-en/stackable.chunk.html
    • /usr/share/doc/php-manual-en/stackable.isrunning.html
    • /usr/share/doc/php-manual-en/stackable.isterminated.html
    • /usr/share/doc/php-manual-en/stackable.iswaiting.html
    • /usr/share/doc/php-manual-en/stackable.lock.html
    • /usr/share/doc/php-manual-en/stackable.merge.html
    • /usr/share/doc/php-manual-en/stackable.notify.html
    • /usr/share/doc/php-manual-en/stackable.pop.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/stackable.shift.html
    • /usr/share/doc/php-manual-en/stackable.synchronized.html
    • /usr/share/doc/php-manual-en/stackable.unlock.html
    • /usr/share/doc/php-manual-en/stackable.wait.html
    • /usr/share/doc/php-manual-en/stats.configuration.html
    • /usr/share/doc/php-manual-en/stats.constants.html
    • /usr/share/doc/php-manual-en/stats.installation.html
    • /usr/share/doc/php-manual-en/stats.requirements.html
    • /usr/share/doc/php-manual-en/stats.resources.html
    • /usr/share/doc/php-manual-en/stats.setup.html
    • /usr/share/doc/php-manual-en/stomp.abort.html
    • /usr/share/doc/php-manual-en/stomp.ack.html
    • /usr/share/doc/php-manual-en/stomp.begin.html
    • /usr/share/doc/php-manual-en/stomp.commit.html
    • /usr/share/doc/php-manual-en/stomp.configuration.html
    • /usr/share/doc/php-manual-en/stomp.construct.html
    • /usr/share/doc/php-manual-en/stomp.destruct.html
    • /usr/share/doc/php-manual-en/stomp.error.html
    • /usr/share/doc/php-manual-en/stomp.examples.html
    • /usr/share/doc/php-manual-en/stomp.getdetails.html
    • /usr/share/doc/php-manual-en/stomp.getreadtimeout.html
    • /usr/share/doc/php-manual-en/stomp.getsessionid.html
    • /usr/share/doc/php-manual-en/stomp.hasframe.html
    • /usr/share/doc/php-manual-en/stomp.installation.html
    • /usr/share/doc/php-manual-en/stomp.readframe.html
    • /usr/share/doc/php-manual-en/stomp.requirements.html
    • /usr/share/doc/php-manual-en/stomp.resources.html
    • /usr/share/doc/php-manual-en/stomp.send.html
    • /usr/share/doc/php-manual-en/stomp.setreadtimeout.html
    • /usr/share/doc/php-manual-en/stomp.setup.html
    • /usr/share/doc/php-manual-en/stomp.subscribe.html
    • /usr/share/doc/php-manual-en/stomp.unsubscribe.html
    • /usr/share/doc/php-manual-en/stompframe.construct.html
    • /usr/share/doc/php-manual-en/stream.configuration.html
    • /usr/share/doc/php-manual-en/stream.constants.html
    • /usr/share/doc/php-manual-en/stream.contexts.html
    • /usr/share/doc/php-manual-en/stream.errors.html
    • /usr/share/doc/php-manual-en/stream.examples.html
    • /usr/share/doc/php-manual-en/stream.filters.html
    • /usr/share/doc/php-manual-en/stream.installation.html
    • /usr/share/doc/php-manual-en/stream.requirements.html
    • /usr/share/doc/php-manual-en/stream.resources.html
    • /usr/share/doc/php-manual-en/stream.setup.html
    • /usr/share/doc/php-manual-en/stream.streamwrapper.example-1.html
    • /usr/share/doc/php-manual-en/streamwrapper.construct.html
    • /usr/share/doc/php-manual-en/streamwrapper.destruct.html
    • /usr/share/doc/php-manual-en/streamwrapper.dir-closedir.html
    • /usr/share/doc/php-manual-en/streamwrapper.dir-opendir.html
    • /usr/share/doc/php-manual-en/streamwrapper.dir-readdir.html
    • /usr/share/doc/php-manual-en/streamwrapper.dir-rewinddir.html
    • /usr/share/doc/php-manual-en/streamwrapper.mkdir.html
    • /usr/share/doc/php-manual-en/streamwrapper.rename.html
    • /usr/share/doc/php-manual-en/streamwrapper.rmdir.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/streamwrapper.unlink.html
    • /usr/share/doc/php-manual-en/streamwrapper.url-stat.html
    • /usr/share/doc/php-manual-en/string.constants.html
    • /usr/share/doc/php-manual-en/strings.configuration.html
    • /usr/share/doc/php-manual-en/strings.installation.html
    • /usr/share/doc/php-manual-en/strings.requirements.html
    • /usr/share/doc/php-manual-en/strings.resources.html
    • /usr/share/doc/php-manual-en/strings.setup.html
    • /usr/share/doc/php-manual-en/svm.configuration.html
    • /usr/share/doc/php-manual-en/svm.construct.html
    • /usr/share/doc/php-manual-en/svm.crossvalidate.html
    • /usr/share/doc/php-manual-en/svm.examples.html
    • /usr/share/doc/php-manual-en/svm.getoptions.html
    • /usr/share/doc/php-manual-en/svm.installation.html
    • /usr/share/doc/php-manual-en/svm.requirements.html
    • /usr/share/doc/php-manual-en/svm.resources.html
    • /usr/share/doc/php-manual-en/svm.setoptions.html
    • /usr/share/doc/php-manual-en/svm.setup.html
    • /usr/share/doc/php-manual-en/svm.train.html
    • /usr/share/doc/php-manual-en/svmmodel.checkprobabilitymodel.html
    • /usr/share/doc/php-manual-en/svmmodel.construct.html
    • /usr/share/doc/php-manual-en/svmmodel.getlabels.html
    • /usr/share/doc/php-manual-en/svmmodel.getnrclass.html
    • /usr/share/doc/php-manual-en/svmmodel.getsvmtype.html
    • /usr/share/doc/php-manual-en/svmmodel.getsvrprobability.html
    • /usr/share/doc/php-manual-en/svmmodel.load.html
    • /usr/share/doc/php-manual-en/svmmodel.predict-probability.html
    • /usr/share/doc/php-manual-en/svmmodel.predict.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/svn.configuration.html
    • /usr/share/doc/php-manual-en/svn.constants.html
    • /usr/share/doc/php-manual-en/svn.installation.html
    • /usr/share/doc/php-manual-en/svn.requirements.html
    • /usr/share/doc/php-manual-en/svn.resources.html
    • /usr/share/doc/php-manual-en/svn.setup.html
    • /usr/share/doc/php-manual-en/swf.configuration.html
    • /usr/share/doc/php-manual-en/swf.constants.html
    • /usr/share/doc/php-manual-en/swf.examples-basic.html
    • /usr/share/doc/php-manual-en/swf.examples.html
    • /usr/share/doc/php-manual-en/swf.installation.html
    • /usr/share/doc/php-manual-en/swf.requirements.html
    • /usr/share/doc/php-manual-en/swf.resources.html
    • /usr/share/doc/php-manual-en/swf.setup.html
    • /usr/share/doc/php-manual-en/swfaction.construct.html
    • /usr/share/doc/php-manual-en/swfbitmap.construct.html
    • /usr/share/doc/php-manual-en/swfbitmap.getheight.html
    • /usr/share/doc/php-manual-en/swfbitmap.getwidth.html
    • /usr/share/doc/php-manual-en/swfbutton.addaction.html
    • /usr/share/doc/php-manual-en/swfbutton.addasound.html
    • /usr/share/doc/php-manual-en/swfbutton.addshape.html
    • /usr/share/doc/php-manual-en/swfbutton.construct.html
    • /usr/share/doc/php-manual-en/swfbutton.setaction.html
    • /usr/share/doc/php-manual-en/swfbutton.setdown.html
    • /usr/share/doc/php-manual-en/swfbutton.sethit.html
    • /usr/share/doc/php-manual-en/swfbutton.setmenu.html
    • /usr/share/doc/php-manual-en/swfbutton.setover.html
    • /usr/share/doc/php-manual-en/swfbutton.setup.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.addaction.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.addcolor.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.endmask.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getrot.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getx.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getxscale.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getxskew.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.gety.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getyscale.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.getyskew.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.move.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.moveto.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.multcolor.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.remove.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.rotate.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.rotateto.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.scale.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.scaleto.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.setdepth.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.setmasklevel.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.setmatrix.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.setname.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.setratio.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.skewx.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.skewxto.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.skewy.html
    • /usr/share/doc/php-manual-en/swfdisplayitem.skewyto.html
    • /usr/share/doc/php-manual-en/swffill.moveto.html
    • /usr/share/doc/php-manual-en/swffill.rotateto.html
    • /usr/share/doc/php-manual-en/swffill.scaleto.html
    • /usr/share/doc/php-manual-en/swffill.skewxto.html
    • /usr/share/doc/php-manual-en/swffill.skewyto.html
    • /usr/share/doc/php-manual-en/swffont.construct.html
    • /usr/share/doc/php-manual-en/swffont.getascent.html
    • /usr/share/doc/php-manual-en/swffont.getdescent.html
    • /usr/share/doc/php-manual-en/swffont.getleading.html
    • /usr/share/doc/php-manual-en/swffont.getshape.html
    • /usr/share/doc/php-manual-en/swffont.getutf8width.html
    • /usr/share/doc/php-manual-en/swffont.getwidth.html
    • /usr/share/doc/php-manual-en/swffontchar.addchars.html
    • /usr/share/doc/php-manual-en/swffontchar.addutf8chars.html
    • /usr/share/doc/php-manual-en/swfgradient.addentry.html
    • /usr/share/doc/php-manual-en/swfgradient.construct.html
    • /usr/share/doc/php-manual-en/swfmorph.construct.html
    • /usr/share/doc/php-manual-en/swfmorph.getshape1.html
    • /usr/share/doc/php-manual-en/swfmorph.getshape2.html
    • /usr/share/doc/php-manual-en/swfmovie.add.html
    • /usr/share/doc/php-manual-en/swfmovie.addexport.html
    • /usr/share/doc/php-manual-en/swfmovie.addfont.html
    • /usr/share/doc/php-manual-en/swfmovie.construct.html
    • /usr/share/doc/php-manual-en/swfmovie.importchar.html
    • /usr/share/doc/php-manual-en/swfmovie.importfont.html
    • /usr/share/doc/php-manual-en/swfmovie.labelframe.html
    • /usr/share/doc/php-manual-en/swfmovie.nextframe.html
    • /usr/share/doc/php-manual-en/swfmovie.output.html
    • /usr/share/doc/php-manual-en/swfmovie.remove.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/swfmovie.savetofile.html
    • /usr/share/doc/php-manual-en/swfmovie.setbackground.html
    • /usr/share/doc/php-manual-en/swfmovie.setdimension.html
    • /usr/share/doc/php-manual-en/swfmovie.setframes.html
    • /usr/share/doc/php-manual-en/swfmovie.setrate.html
    • /usr/share/doc/php-manual-en/swfmovie.startsound.html
    • /usr/share/doc/php-manual-en/swfmovie.stopsound.html
    • /usr/share/doc/php-manual-en/swfmovie.streammp3.html
    • /usr/share/doc/php-manual-en/swfmovie.writeexports.html
    • /usr/share/doc/php-manual-en/swfprebuiltclip.construct.html
    • /usr/share/doc/php-manual-en/swfshape.addfill.html
    • /usr/share/doc/php-manual-en/swfshape.construct.html
    • /usr/share/doc/php-manual-en/swfshape.drawarc.html
    • /usr/share/doc/php-manual-en/swfshape.drawcircle.html
    • /usr/share/doc/php-manual-en/swfshape.drawcubic.html
    • /usr/share/doc/php-manual-en/swfshape.drawcubicto.html
    • /usr/share/doc/php-manual-en/swfshape.drawcurve.html
    • /usr/share/doc/php-manual-en/swfshape.drawcurveto.html
    • /usr/share/doc/php-manual-en/swfshape.drawglyph.html
    • /usr/share/doc/php-manual-en/swfshape.drawline.html
    • /usr/share/doc/php-manual-en/swfshape.drawlineto.html
    • /usr/share/doc/php-manual-en/swfshape.movepen.html
    • /usr/share/doc/php-manual-en/swfshape.movepento.html
    • /usr/share/doc/php-manual-en/swfshape.setleftfill.html
    • /usr/share/doc/php-manual-en/swfshape.setline.html
    • /usr/share/doc/php-manual-en/swfshape.setrightfill.html
    • /usr/share/doc/php-manual-en/swfsound.construct.html
    • /usr/share/doc/php-manual-en/swfsoundinstance.loopcount.html
    • /usr/share/doc/php-manual-en/swfsoundinstance.loopinpoint.html
    • /usr/share/doc/php-manual-en/swfsoundinstance.loopoutpoint.html
    • /usr/share/doc/php-manual-en/swfsoundinstance.nomultiple.html
    • /usr/share/doc/php-manual-en/swfsprite.add.html
    • /usr/share/doc/php-manual-en/swfsprite.construct.html
    • /usr/share/doc/php-manual-en/swfsprite.labelframe.html
    • /usr/share/doc/php-manual-en/swfsprite.nextframe.html
    • /usr/share/doc/php-manual-en/swfsprite.remove.html
    • /usr/share/doc/php-manual-en/swfsprite.setframes.html
    • /usr/share/doc/php-manual-en/swfsprite.startsound.html
    • /usr/share/doc/php-manual-en/swfsprite.stopsound.html
    • /usr/share/doc/php-manual-en/swftext.addstring.html
    • /usr/share/doc/php-manual-en/swftext.addutf8string.html
    • /usr/share/doc/php-manual-en/swftext.construct.html
    • /usr/share/doc/php-manual-en/swftext.getascent.html
    • /usr/share/doc/php-manual-en/swftext.getdescent.html
    • /usr/share/doc/php-manual-en/swftext.getleading.html
    • /usr/share/doc/php-manual-en/swftext.getutf8width.html
    • /usr/share/doc/php-manual-en/swftext.getwidth.html
    • /usr/share/doc/php-manual-en/swftext.moveto.html
    • /usr/share/doc/php-manual-en/swftext.setcolor.html
    • /usr/share/doc/php-manual-en/swftext.setfont.html
    • /usr/share/doc/php-manual-en/swftext.setheight.html
    • /usr/share/doc/php-manual-en/swftext.setspacing.html
    • /usr/share/doc/php-manual-en/swftextfield.addchars.html
    • /usr/share/doc/php-manual-en/swftextfield.addstring.html
    • /usr/share/doc/php-manual-en/swftextfield.align.html
    • /usr/share/doc/php-manual-en/swftextfield.construct.html
    • /usr/share/doc/php-manual-en/swftextfield.setbounds.html
    • /usr/share/doc/php-manual-en/swftextfield.setcolor.html
    • /usr/share/doc/php-manual-en/swftextfield.setfont.html
    • /usr/share/doc/php-manual-en/swftextfield.setheight.html
    • /usr/share/doc/php-manual-en/swftextfield.setindentation.html
    • /usr/share/doc/php-manual-en/swftextfield.setleftmargin.html
    • /usr/share/doc/php-manual-en/swftextfield.setlinespacing.html
    • /usr/share/doc/php-manual-en/swftextfield.setmargins.html
    • /usr/share/doc/php-manual-en/swftextfield.setname.html
    • /usr/share/doc/php-manual-en/swftextfield.setpadding.html
    • /usr/share/doc/php-manual-en/swftextfield.setrightmargin.html
    • /usr/share/doc/php-manual-en/swfvideostream.construct.html
    • /usr/share/doc/php-manual-en/swfvideostream.getnumframes.html
    • /usr/share/doc/php-manual-en/swfvideostream.setdimension.html
    • /usr/share/doc/php-manual-en/swish.configuration.html
    • /usr/share/doc/php-manual-en/swish.constants.html
    • /usr/share/doc/php-manual-en/swish.construct.html
    • /usr/share/doc/php-manual-en/swish.examples-basic.html
    • /usr/share/doc/php-manual-en/swish.examples.html
    • /usr/share/doc/php-manual-en/swish.getmetalist.html
    • /usr/share/doc/php-manual-en/swish.getpropertylist.html
    • /usr/share/doc/php-manual-en/swish.installation.html
    • /usr/share/doc/php-manual-en/swish.prepare.html
    • /usr/share/doc/php-manual-en/swish.query.html
    • /usr/share/doc/php-manual-en/swish.requirements.html
    • /usr/share/doc/php-manual-en/swish.resources.html
    • /usr/share/doc/php-manual-en/swish.setup.html
    • /usr/share/doc/php-manual-en/swishresult.getmetalist.html
    • /usr/share/doc/php-manual-en/swishresult.stem.html
    • /usr/share/doc/php-manual-en/swishresults.getparsedwords.html
    • /usr/share/doc/php-manual-en/swishresults.getremovedstopwords.html
    • /usr/share/doc/php-manual-en/swishresults.nextresult.html
    • /usr/share/doc/php-manual-en/swishresults.seekresult.html
    • /usr/share/doc/php-manual-en/swishsearch.execute.html
    • /usr/share/doc/php-manual-en/swishsearch.resetlimit.html
    • /usr/share/doc/php-manual-en/swishsearch.setlimit.html
    • /usr/share/doc/php-manual-en/swishsearch.setphrasedelimiter.html
    • /usr/share/doc/php-manual-en/swishsearch.setsort.html
    • /usr/share/doc/php-manual-en/swishsearch.setstructure.html
    • /usr/share/doc/php-manual-en/sybase.configuration.html
    • /usr/share/doc/php-manual-en/sybase.constants.html
    • /usr/share/doc/php-manual-en/sybase.installation.html
    • /usr/share/doc/php-manual-en/sybase.requirements.html
    • /usr/share/doc/php-manual-en/sybase.resources.html
    • /usr/share/doc/php-manual-en/sybase.setup.html
    • /usr/share/doc/php-manual-en/tag.getalbum.html
    • /usr/share/doc/php-manual-en/tag.getartist.html
    • /usr/share/doc/php-manual-en/tag.getcomment.html
    • /usr/share/doc/php-manual-en/tag.getgenre.html
    • /usr/share/doc/php-manual-en/tag.gettitle.html
    • /usr/share/doc/php-manual-en/tag.gettrack.html
    • /usr/share/doc/php-manual-en/tag.getyear.html
    • /usr/share/doc/php-manual-en/tag.isempty.html
    • /usr/share/doc/php-manual-en/taint.configuration.html
    • /usr/share/doc/php-manual-en/taint.detail.basic.html
    • /usr/share/doc/php-manual-en/taint.detail.html
    • /usr/share/doc/php-manual-en/taint.detail.taint.html
    • /usr/share/doc/php-manual-en/taint.detail.untaint.html
    • /usr/share/doc/php-manual-en/taint.installation.html
    • /usr/share/doc/php-manual-en/taint.requirements.html
    • /usr/share/doc/php-manual-en/taint.resources.html
    • /usr/share/doc/php-manual-en/taint.setup.html
    • /usr/share/doc/php-manual-en/tcpwrap.configuration.html
    • /usr/share/doc/php-manual-en/tcpwrap.constants.html
    • /usr/share/doc/php-manual-en/tcpwrap.installation.html
    • /usr/share/doc/php-manual-en/tcpwrap.requirements.html
    • /usr/share/doc/php-manual-en/tcpwrap.resources.html
    • /usr/share/doc/php-manual-en/tcpwrap.setup.html
    • /usr/share/doc/php-manual-en/thread.chunk.html
    • /usr/share/doc/php-manual-en/thread.getcreatorid.html
    • /usr/share/doc/php-manual-en/thread.getthreadid.html
    • /usr/share/doc/php-manual-en/thread.isjoined.html
    • /usr/share/doc/php-manual-en/thread.isrunning.html
    • /usr/share/doc/php-manual-en/thread.isstarted.html
    • /usr/share/doc/php-manual-en/thread.isterminated.html
    • /usr/share/doc/php-manual-en/thread.iswaiting.html
    • /usr/share/doc/php-manual-en/thread.join.html
    • /usr/share/doc/php-manual-en/thread.lock.html
    • /usr/share/doc/php-manual-en/thread.merge.html
    • /usr/share/doc/php-manual-en/thread.notify.html
    • /usr/share/doc/php-manual-en/thread.pop.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/thread.shift.html
    • /usr/share/doc/php-manual-en/thread.start.html
    • /usr/share/doc/php-manual-en/thread.synchronized.html
    • /usr/share/doc/php-manual-en/thread.unlock.html
    • /usr/share/doc/php-manual-en/thread.wait.html
    • /usr/share/doc/php-manual-en/tidy.body.html
    • /usr/share/doc/php-manual-en/tidy.cleanrepair.html
    • /usr/share/doc/php-manual-en/tidy.configuration.html
    • /usr/share/doc/php-manual-en/tidy.constants.html
    • /usr/share/doc/php-manual-en/tidy.construct.html
    • /usr/share/doc/php-manual-en/tidy.diagnose.html
    • /usr/share/doc/php-manual-en/tidy.examples.basic.html
    • /usr/share/doc/php-manual-en/tidy.examples.html
    • /usr/share/doc/php-manual-en/tidy.getconfig.html
    • /usr/share/doc/php-manual-en/tidy.gethtmlver.html
    • /usr/share/doc/php-manual-en/tidy.getopt.html
    • /usr/share/doc/php-manual-en/tidy.getoptdoc.html
    • /usr/share/doc/php-manual-en/tidy.getrelease.html
    • /usr/share/doc/php-manual-en/tidy.getstatus.html
    • /usr/share/doc/php-manual-en/tidy.head.html
    • /usr/share/doc/php-manual-en/tidy.html.html
    • /usr/share/doc/php-manual-en/tidy.installation.html
    • /usr/share/doc/php-manual-en/tidy.isxhtml.html
    • /usr/share/doc/php-manual-en/tidy.isxml.html
    • /usr/share/doc/php-manual-en/tidy.parsefile.html
    • /usr/share/doc/php-manual-en/tidy.parsestring.html
    • /usr/share/doc/php-manual-en/tidy.props.errorbuffer.html
    • /usr/share/doc/php-manual-en/tidy.repairfile.html
    • /usr/share/doc/php-manual-en/tidy.repairstring.html
    • /usr/share/doc/php-manual-en/tidy.requirements.html
    • /usr/share/doc/php-manual-en/tidy.resources.html
    • /usr/share/doc/php-manual-en/tidy.root.html
    • /usr/share/doc/php-manual-en/tidy.setup.html
    • /usr/share/doc/php-manual-en/tidynode.getparent.html
    • /usr/share/doc/php-manual-en/tidynode.haschildren.html
    • /usr/share/doc/php-manual-en/tidynode.hassiblings.html
    • /usr/share/doc/php-manual-en/tidynode.isasp.html
    • /usr/share/doc/php-manual-en/tidynode.iscomment.html
    • /usr/share/doc/php-manual-en/tidynode.ishtml.html
    • /usr/share/doc/php-manual-en/tidynode.isjste.html
    • /usr/share/doc/php-manual-en/tidynode.isphp.html
    • /usr/share/doc/php-manual-en/tidynode.istext.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/timezones.america.html
    • /usr/share/doc/php-manual-en/timezones.antarctica.html
    • /usr/share/doc/php-manual-en/timezones.arctic.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/timezones.atlantic.html
    • /usr/share/doc/php-manual-en/timezones.australia.html
    • /usr/share/doc/php-manual-en/timezones.europe.html
    • /usr/share/doc/php-manual-en/timezones.html
    • /usr/share/doc/php-manual-en/timezones.indian.html
    • /usr/share/doc/php-manual-en/timezones.others.html
    • /usr/share/doc/php-manual-en/timezones.pacific.html
    • /usr/share/doc/php-manual-en/tokenizer.configuration.html
    • /usr/share/doc/php-manual-en/tokenizer.constants.html
    • /usr/share/doc/php-manual-en/tokenizer.examples.html
    • /usr/share/doc/php-manual-en/tokenizer.installation.html
    • /usr/share/doc/php-manual-en/tokenizer.requirements.html
    • /usr/share/doc/php-manual-en/tokenizer.resources.html
    • /usr/share/doc/php-manual-en/tokenizer.setup.html
    • /usr/share/doc/php-manual-en/tokens.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.configuration.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.constants.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.examples.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.installation.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.requirements.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.resources.html
    • /usr/share/doc/php-manual-en/tokyo-tyrant.setup.html
    • /usr/share/doc/php-manual-en/tokyotyrant.add.html
    • /usr/share/doc/php-manual-en/tokyotyrant.connect.html
    • /usr/share/doc/php-manual-en/tokyotyrant.connecturi.html
    • /usr/share/doc/php-manual-en/tokyotyrant.construct.html
    • /usr/share/doc/php-manual-en/tokyotyrant.copy.html
    • /usr/share/doc/php-manual-en/tokyotyrant.ext.html
    • /usr/share/doc/php-manual-en/tokyotyrant.fwmkeys.html
    • /usr/share/doc/php-manual-en/tokyotyrant.get.html
    • /usr/share/doc/php-manual-en/tokyotyrant.getiterator.html
    • /usr/share/doc/php-manual-en/tokyotyrant.num.html
    • /usr/share/doc/php-manual-en/tokyotyrant.out.html
    • /usr/share/doc/php-manual-en/tokyotyrant.put.html
    • /usr/share/doc/php-manual-en/tokyotyrant.putcat.html
    • /usr/share/doc/php-manual-en/tokyotyrant.putkeep.html
    • /usr/share/doc/php-manual-en/tokyotyrant.putnr.html
    • /usr/share/doc/php-manual-en/tokyotyrant.putshl.html
    • /usr/share/doc/php-manual-en/tokyotyrant.restore.html
    • /usr/share/doc/php-manual-en/tokyotyrant.setmaster.html
    • /usr/share/doc/php-manual-en/tokyotyrant.size.html
    • /usr/share/doc/php-manual-en/tokyotyrant.stat.html
    • /usr/share/doc/php-manual-en/tokyotyrant.sync.html
    • /usr/share/doc/php-manual-en/tokyotyrant.tune.html
    • /usr/share/doc/php-manual-en/tokyotyrant.vanish.html
    • /usr/share/doc/php-manual-en/tokyotyrantiterator.construct.html
    • /usr/share/doc/php-manual-en/tokyotyrantiterator.current.html
    • /usr/share/doc/php-manual-en/tokyotyrantiterator.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/tokyotyrantiterator.rewind.html
    • /usr/share/doc/php-manual-en/tokyotyrantiterator.valid.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.addcond.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.construct.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.count.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.current.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.hint.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.key.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.metasearch.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/tokyotyrantquery.out.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.rewind.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/tokyotyrantquery.setlimit.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.setorder.html
    • /usr/share/doc/php-manual-en/tokyotyrantquery.valid.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.add.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.genuid.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.get.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.getiterator.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.getquery.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.out.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.put.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.putcat.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.putkeep.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.putnr.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.putshl.html
    • /usr/share/doc/php-manual-en/tokyotyranttable.setindex.html
    • /usr/share/doc/php-manual-en/trader.configuration.html
    • /usr/share/doc/php-manual-en/trader.constants.html
    • /usr/share/doc/php-manual-en/trader.installation.html
    • /usr/share/doc/php-manual-en/trader.requirements.html
    • /usr/share/doc/php-manual-en/trader.setup.html
    • /usr/share/doc/php-manual-en/transliterator.construct.html
    • /usr/share/doc/php-manual-en/transliterator.create.html
    • /usr/share/doc/php-manual-en/transliterator.createfromrules.html
    • /usr/share/doc/php-manual-en/transliterator.createinverse.html
    • /usr/share/doc/php-manual-en/transliterator.geterrorcode.html
    • /usr/share/doc/php-manual-en/transliterator.geterrormessage.html
    • /usr/share/doc/php-manual-en/transliterator.listids.html
    • /usr/share/doc/php-manual-en/transliterator.transliterate.html
    • /usr/share/doc/php-manual-en/transports.html
    • /usr/share/doc/php-manual-en/transports.inet.html
    • /usr/share/doc/php-manual-en/transports.unix.html
    • /usr/share/doc/php-manual-en/tutorial.firstpage.html
    • /usr/share/doc/php-manual-en/tutorial.forms.html
    • /usr/share/doc/php-manual-en/tutorial.html
    • /usr/share/doc/php-manual-en/tutorial.oldcode.html
    • /usr/share/doc/php-manual-en/tutorial.requirements.html
    • /usr/share/doc/php-manual-en/tutorial.useful.html
    • /usr/share/doc/php-manual-en/tutorial.whatsnext.html
    • /usr/share/doc/php-manual-en/types.comparisons.html
    • /usr/share/doc/php-manual-en/uconverter.construct.html
    • /usr/share/doc/php-manual-en/uconverter.convert.html
    • /usr/share/doc/php-manual-en/uconverter.fromucallback.html
    • /usr/share/doc/php-manual-en/uconverter.getaliases.html
    • /usr/share/doc/php-manual-en/uconverter.getavailable.html
    • /usr/share/doc/php-manual-en/uconverter.getdestinationencoding.html
    • /usr/share/doc/php-manual-en/uconverter.getdestinationtype.html
    • /usr/share/doc/php-manual-en/uconverter.geterrorcode.html
    • /usr/share/doc/php-manual-en/uconverter.geterrormessage.html
    • /usr/share/doc/php-manual-en/uconverter.getsourceencoding.html
    • /usr/share/doc/php-manual-en/uconverter.getsourcetype.html
    • /usr/share/doc/php-manual-en/uconverter.getstandards.html
    • /usr/share/doc/php-manual-en/uconverter.getsubstchars.html
    • /usr/share/doc/php-manual-en/uconverter.reasontext.html
    • /usr/share/doc/php-manual-en/uconverter.setdestinationencoding.html
    • /usr/share/doc/php-manual-en/uconverter.setsourceencoding.html
    • /usr/share/doc/php-manual-en/uconverter.setsubstchars.html
    • /usr/share/doc/php-manual-en/uconverter.toucallback.html
    • /usr/share/doc/php-manual-en/uconverter.transcode.html
    • /usr/share/doc/php-manual-en/uodbc.constants.html
    • /usr/share/doc/php-manual-en/uodbc.requirements.html
    • /usr/share/doc/php-manual-en/uodbc.resources.html
    • /usr/share/doc/php-manual-en/uodbc.setup.html
    • /usr/share/doc/php-manual-en/url.configuration.html
    • /usr/share/doc/php-manual-en/url.constants.html
    • /usr/share/doc/php-manual-en/url.installation.html
    • /usr/share/doc/php-manual-en/url.requirements.html
    • /usr/share/doc/php-manual-en/url.resources.html
    • /usr/share/doc/php-manual-en/url.setup.html
    • /usr/share/doc/php-manual-en/userlandnaming.globalnamespace.html
    • /usr/share/doc/php-manual-en/userlandnaming.html
    • /usr/share/doc/php-manual-en/userlandnaming.rules.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/v8js.configuration.html
    • /usr/share/doc/php-manual-en/v8js.construct.html
    • /usr/share/doc/php-manual-en/v8js.examples.html
    • /usr/share/doc/php-manual-en/v8js.executestring.html
    • /usr/share/doc/php-manual-en/v8js.getextensions.html
    • /usr/share/doc/php-manual-en/v8js.getpendingexception.html
    • /usr/share/doc/php-manual-en/v8js.installation.html
    • /usr/share/doc/php-manual-en/v8js.registerextension.html
    • /usr/share/doc/php-manual-en/v8js.requirements.html
    • /usr/share/doc/php-manual-en/v8js.resources.html
    • /usr/share/doc/php-manual-en/v8js.setup.html
    • /usr/share/doc/php-manual-en/v8jsexception.getjsfilename.html
    • /usr/share/doc/php-manual-en/v8jsexception.getjslinenumber.html
    • /usr/share/doc/php-manual-en/v8jsexception.getjssourceline.html
    • /usr/share/doc/php-manual-en/v8jsexception.getjstrace.html
    • /usr/share/doc/php-manual-en/var.configuration.html
    • /usr/share/doc/php-manual-en/var.constants.html
    • /usr/share/doc/php-manual-en/var.installation.html
    • /usr/share/doc/php-manual-en/var.requirements.html
    • /usr/share/doc/php-manual-en/var.resources.html
    • /usr/share/doc/php-manual-en/var.setup.html
    • /usr/share/doc/php-manual-en/varnish.configuration.html
    • /usr/share/doc/php-manual-en/varnish.constants.html
    • /usr/share/doc/php-manual-en/varnish.example.admin.html
    • /usr/share/doc/php-manual-en/varnish.example.log.html
    • /usr/share/doc/php-manual-en/varnish.example.stat.html
    • /usr/share/doc/php-manual-en/varnish.examples.html
    • /usr/share/doc/php-manual-en/varnish.installation.html
    • /usr/share/doc/php-manual-en/varnish.requirements.html
    • /usr/share/doc/php-manual-en/varnish.resources.html
    • /usr/share/doc/php-manual-en/varnish.setup.html
    • /usr/share/doc/php-manual-en/varnishadmin.auth.html
    • /usr/share/doc/php-manual-en/varnishadmin.ban.html
    • /usr/share/doc/php-manual-en/varnishadmin.banurl.html
    • /usr/share/doc/php-manual-en/varnishadmin.clearpanic.html
    • /usr/share/doc/php-manual-en/varnishadmin.connect.html
    • /usr/share/doc/php-manual-en/varnishadmin.construct.html
    • /usr/share/doc/php-manual-en/varnishadmin.disconnect.html
    • /usr/share/doc/php-manual-en/varnishadmin.getpanic.html
    • /usr/share/doc/php-manual-en/varnishadmin.getparams.html
    • /usr/share/doc/php-manual-en/varnishadmin.isrunning.html
    • /usr/share/doc/php-manual-en/varnishadmin.setcompat.html
    • /usr/share/doc/php-manual-en/varnishadmin.sethost.html
    • /usr/share/doc/php-manual-en/varnishadmin.setident.html
    • /usr/share/doc/php-manual-en/varnishadmin.setparam.html
    • /usr/share/doc/php-manual-en/varnishadmin.setport.html
    • /usr/share/doc/php-manual-en/varnishadmin.setsecret.html
    • /usr/share/doc/php-manual-en/varnishadmin.settimeout.html
    • /usr/share/doc/php-manual-en/varnishadmin.start.html
    • /usr/share/doc/php-manual-en/varnishadmin.stop.html
    • /usr/share/doc/php-manual-en/varnishlog.construct.html
    • /usr/share/doc/php-manual-en/varnishlog.getline.html
    • /usr/share/doc/php-manual-en/varnishlog.gettagname.html
    • /usr/share/doc/php-manual-en/varnishstat.construct.html
    • /usr/share/doc/php-manual-en/varnishstat.getsnapshot.html
    • /usr/share/doc/php-manual-en/vpopmail.configuration.html
    • /usr/share/doc/php-manual-en/vpopmail.constants.html
    • /usr/share/doc/php-manual-en/vpopmail.installation.html
    • /usr/share/doc/php-manual-en/vpopmail.requirements.html
    • /usr/share/doc/php-manual-en/vpopmail.resources.html
    • /usr/share/doc/php-manual-en/vpopmail.setup.html
    • /usr/share/doc/php-manual-en/w32api.configuration.html
    • /usr/share/doc/php-manual-en/w32api.constants.html
    • /usr/share/doc/php-manual-en/w32api.examples-uptime.html
    • /usr/share/doc/php-manual-en/w32api.examples.html
    • /usr/share/doc/php-manual-en/w32api.installation.html
    • /usr/share/doc/php-manual-en/w32api.requirements.html
    • /usr/share/doc/php-manual-en/w32api.resources.html
    • /usr/share/doc/php-manual-en/w32api.setup.html
    • /usr/share/doc/php-manual-en/wddx.configuration.html
    • /usr/share/doc/php-manual-en/wddx.constants.html
    • /usr/share/doc/php-manual-en/wddx.examples-serialize.html
    • /usr/share/doc/php-manual-en/wddx.examples.html
    • /usr/share/doc/php-manual-en/wddx.installation.html
    • /usr/share/doc/php-manual-en/wddx.requirements.html
    • /usr/share/doc/php-manual-en/wddx.resources.html
    • /usr/share/doc/php-manual-en/wddx.setup.html
    • /usr/share/doc/php-manual-en/weakmap.construct.html
    • /usr/share/doc/php-manual-en/weakmap.count.html
    • /usr/share/doc/php-manual-en/weakmap.current.html
    • /usr/share/doc/php-manual-en/weakmap.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/weakmap.offsetexists.html
    • /usr/share/doc/php-manual-en/weakmap.offsetget.html
    • /usr/share/doc/php-manual-en/weakmap.offsetset.html
    • /usr/share/doc/php-manual-en/weakmap.offsetunset.html
    • /usr/share/doc/php-manual-en/weakmap.rewind.html
    • /usr/share/doc/php-manual-en/weakmap.valid.html
    • /usr/share/doc/php-manual-en/weakref.acquire.html
    • /usr/share/doc/php-manual-en/weakref.construct.html
    • /usr/share/doc/php-manual-en/weakref.get.html
    • /usr/share/doc/php-manual-en/weakref.installation.html
    • /usr/share/doc/php-manual-en/weakref.release.html
    • /usr/share/doc/php-manual-en/weakref.requirements.html
    • /usr/share/doc/php-manual-en/weakref.resources.html
    • /usr/share/doc/php-manual-en/weakref.setup.html
    • /usr/share/doc/php-manual-en/weakref.valid.html
    • /usr/share/doc/php-manual-en/win32ps.configuration.html
    • /usr/share/doc/php-manual-en/win32ps.constants.html
    • /usr/share/doc/php-manual-en/win32ps.examples-process.html
    • /usr/share/doc/php-manual-en/win32ps.examples.html
    • /usr/share/doc/php-manual-en/win32ps.installation.html
    • /usr/share/doc/php-manual-en/win32ps.requirements.html
    • /usr/share/doc/php-manual-en/win32ps.resources.html
    • /usr/share/doc/php-manual-en/win32ps.setup.html
    • /usr/share/doc/php-manual-en/win32service.configuration.html
    • /usr/share/doc/php-manual-en/win32service.constants.basepriorities.html
    • /usr/share/doc/php-manual-en/win32service.constants.controlsaccepted.html
    • /usr/share/doc/php-manual-en/win32service.constants.errorcontrol.html
    • /usr/share/doc/php-manual-en/win32service.constants.errors.html
    • /usr/share/doc/php-manual-en/win32service.constants.html
    • /usr/share/doc/php-manual-en/win32service.constants.servicecontrol.html
    • /usr/share/doc/php-manual-en/win32service.constants.serviceflag.html
    • /usr/share/doc/php-manual-en/win32service.constants.servicestarttype.html
    • /usr/share/doc/php-manual-en/win32service.constants.servicestatus.html
    • /usr/share/doc/php-manual-en/win32service.constants.servicetype.html
    • /usr/share/doc/php-manual-en/win32service.examples.html
    • /usr/share/doc/php-manual-en/win32service.installation.html
    • /usr/share/doc/php-manual-en/win32service.requirements.html
    • /usr/share/doc/php-manual-en/win32service.resources.html
    • /usr/share/doc/php-manual-en/win32service.setup.html
    • /usr/share/doc/php-manual-en/wincache.configuration.html
    • /usr/share/doc/php-manual-en/wincache.constants.html
    • /usr/share/doc/php-manual-en/wincache.installation.html
    • /usr/share/doc/php-manual-en/wincache.requirements.html
    • /usr/share/doc/php-manual-en/wincache.reroutes.html
    • /usr/share/doc/php-manual-en/wincache.resources.html
    • /usr/share/doc/php-manual-en/wincache.sessionhandler.html
    • /usr/share/doc/php-manual-en/wincache.setup.html
    • /usr/share/doc/php-manual-en/wincache.stats.html
    • /usr/share/doc/php-manual-en/wincache.win32build.building.html
    • /usr/share/doc/php-manual-en/wincache.win32build.html
    • /usr/share/doc/php-manual-en/wincache.win32build.prereq.html
    • /usr/share/doc/php-manual-en/wincache.win32build.verify.html
    • /usr/share/doc/php-manual-en/worker.chunk.html
    • /usr/share/doc/php-manual-en/worker.getcreatorid.html
    • /usr/share/doc/php-manual-en/worker.getstacked.html
    • /usr/share/doc/php-manual-en/worker.getthreadid.html
    • /usr/share/doc/php-manual-en/worker.isshutdown.html
    • /usr/share/doc/php-manual-en/worker.isworking.html
    • /usr/share/doc/php-manual-en/worker.merge.html
    • /usr/share/doc/php-manual-en/worker.pop.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/worker.shift.html
    • /usr/share/doc/php-manual-en/worker.shutdown.html
    • /usr/share/doc/php-manual-en/worker.stack.html
    • /usr/share/doc/php-manual-en/worker.start.html
    • /usr/share/doc/php-manual-en/worker.unstack.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/wrappers.compression.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/wrappers.expect.html
    • /usr/share/doc/php-manual-en/wrappers.file.html
    • /usr/share/doc/php-manual-en/wrappers.ftp.html
    • /usr/share/doc/php-manual-en/wrappers.glob.html
    • /usr/share/doc/php-manual-en/wrappers.html
    • /usr/share/doc/php-manual-en/wrappers.http.html
    • /usr/share/doc/php-manual-en/wrappers.phar.html
    • /usr/share/doc/php-manual-en/wrappers.php.html
    • /usr/share/doc/php-manual-en/wrappers.rar.html
    • /usr/share/doc/php-manual-en/wrappers.ssh2.html
    • /usr/share/doc/php-manual-en/xattr.configuration.html
    • /usr/share/doc/php-manual-en/xattr.constants.html
    • /usr/share/doc/php-manual-en/xattr.installation.html
    • /usr/share/doc/php-manual-en/xattr.requirements.html
    • /usr/share/doc/php-manual-en/xattr.resources.html
    • /usr/share/doc/php-manual-en/xattr.setup.html
    • /usr/share/doc/php-manual-en/xdiff.configuration.html
    • /usr/share/doc/php-manual-en/xdiff.constants.html
    • /usr/share/doc/php-manual-en/xdiff.installation.html
    • /usr/share/doc/php-manual-en/xdiff.requirements.html
    • /usr/share/doc/php-manual-en/xdiff.resources.html
    • /usr/share/doc/php-manual-en/xdiff.setup.html
    • /usr/share/doc/php-manual-en/xhprof.configuration.html
    • /usr/share/doc/php-manual-en/xhprof.constants.html
    • /usr/share/doc/php-manual-en/xhprof.examples.html
    • /usr/share/doc/php-manual-en/xhprof.installation.html
    • /usr/share/doc/php-manual-en/xhprof.requirements.html
    • /usr/share/doc/php-manual-en/xhprof.resources.html
    • /usr/share/doc/php-manual-en/xhprof.setup.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/xml.configuration.html
    • /usr/share/doc/php-manual-en/xml.constants.html
    • /usr/share/doc/php-manual-en/xml.encoding.html
    • /usr/share/doc/php-manual-en/xml.error-codes.html
    • /usr/share/doc/php-manual-en/xml.eventhandlers.html
    • /usr/share/doc/php-manual-en/xml.examples.html
    • /usr/share/doc/php-manual-en/xml.installation.html
    • /usr/share/doc/php-manual-en/xml.requirements.html
    • /usr/share/doc/php-manual-en/xml.resources.html
    • /usr/share/doc/php-manual-en/xml.setup.html
    • /usr/share/doc/php-manual-en/xmldiff-base.construct.html
    • /usr/share/doc/php-manual-en/xmldiff-base.diff.html
    • /usr/share/doc/php-manual-en/xmldiff-base.merge.html
    • /usr/share/doc/php-manual-en/xmldiff-dom.diff.html
    • /usr/share/doc/php-manual-en/xmldiff-dom.merge.html
    • /usr/share/doc/php-manual-en/xmldiff-file.diff.html
    • /usr/share/doc/php-manual-en/xmldiff-file.merge.html
    • /usr/share/doc/php-manual-en/xmldiff-memory.diff.html
    • /usr/share/doc/php-manual-en/xmldiff-memory.merge.html
    • /usr/share/doc/php-manual-en/xmldiff.installation.html
    • /usr/share/doc/php-manual-en/xmldiff.requirements.html
    • /usr/share/doc/php-manual-en/xmldiff.setup.html
    • /usr/share/doc/php-manual-en/xmlreader.close.html
    • /usr/share/doc/php-manual-en/xmlreader.configuration.html
    • /usr/share/doc/php-manual-en/xmlreader.expand.html
    • /usr/share/doc/php-manual-en/xmlreader.getattribute.html
    • /usr/share/doc/php-manual-en/xmlreader.getattributeno.html
    • /usr/share/doc/php-manual-en/xmlreader.getattributens.html
    • /usr/share/doc/php-manual-en/xmlreader.getparserproperty.html
    • /usr/share/doc/php-manual-en/xmlreader.installation.html
    • /usr/share/doc/php-manual-en/xmlreader.isvalid.html
    • /usr/share/doc/php-manual-en/xmlreader.lookupnamespace.html
    • /usr/share/doc/php-manual-en/xmlreader.movetoattribute.html
    • /usr/share/doc/php-manual-en/xmlreader.movetoattributeno.html
    • /usr/share/doc/php-manual-en/xmlreader.movetoattributens.html
    • /usr/share/doc/php-manual-en/xmlreader.movetoelement.html
    • /usr/share/doc/php-manual-en/xmlreader.movetofirstattribute.html
    • /usr/share/doc/php-manual-en/xmlreader.movetonextattribute.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/xmlreader.readinnerxml.html
    • /usr/share/doc/php-manual-en/xmlreader.readouterxml.html
    • /usr/share/doc/php-manual-en/xmlreader.readstring.html
    • /usr/share/doc/php-manual-en/xmlreader.requirements.html
    • /usr/share/doc/php-manual-en/xmlreader.resources.html
    • /usr/share/doc/php-manual-en/xmlreader.setparserproperty.html
    • /usr/share/doc/php-manual-en/xmlreader.setrelaxngschema.html
    • /usr/share/doc/php-manual-en/xmlreader.setrelaxngschemasource.html
    • /usr/share/doc/php-manual-en/xmlreader.setschema.html
    • /usr/share/doc/php-manual-en/xmlreader.setup.html
    • /usr/share/doc/php-manual-en/xmlreader.xml.html
    • /usr/share/doc/php-manual-en/xmlrpc.configuration.html
    • /usr/share/doc/php-manual-en/xmlrpc.constants.html
    • /usr/share/doc/php-manual-en/xmlrpc.installation.html
    • /usr/share/doc/php-manual-en/xmlrpc.requirements.html
    • /usr/share/doc/php-manual-en/xmlrpc.resources.html
    • /usr/share/doc/php-manual-en/xmlrpc.setup.html
    • /usr/share/doc/php-manual-en/xmlwriter.configuration.html
    • /usr/share/doc/php-manual-en/xmlwriter.constants.html
    • /usr/share/doc/php-manual-en/xmlwriter.installation.html
    • /usr/share/doc/php-manual-en/xmlwriter.requirements.html
    • /usr/share/doc/php-manual-en/xmlwriter.resources.html
    • /usr/share/doc/php-manual-en/xmlwriter.setup.html
    • /usr/share/doc/php-manual-en/xsl.configuration.html
    • /usr/share/doc/php-manual-en/xsl.constants.html
    • /usr/share/doc/php-manual-en/xsl.examples-collection.html
    • /usr/share/doc/php-manual-en/xsl.examples.html
    • /usr/share/doc/php-manual-en/xsl.installation.html
    • /usr/share/doc/php-manual-en/xsl.requirements.html
    • /usr/share/doc/php-manual-en/xsl.resources.html
    • /usr/share/doc/php-manual-en/xsl.setup.html
    • /usr/share/doc/php-manual-en/xslt.configuration.html
    • /usr/share/doc/php-manual-en/xslt.constants.html
    • /usr/share/doc/php-manual-en/xslt.installation.html
    • /usr/share/doc/php-manual-en/xslt.requirements.html
    • /usr/share/doc/php-manual-en/xslt.resources.html
    • /usr/share/doc/php-manual-en/xslt.setup.html
    • /usr/share/doc/php-manual-en/xsltprocessor.construct.html
    • /usr/share/doc/php-manual-en/xsltprocessor.getparameter.html
    • /usr/share/doc/php-manual-en/xsltprocessor.getsecurityprefs.html
    • /usr/share/doc/php-manual-en/xsltprocessor.hasexsltsupport.html
    • /usr/share/doc/php-manual-en/xsltprocessor.importstylesheet.html
    • /usr/share/doc/php-manual-en/xsltprocessor.registerphpfunctions.html
    • /usr/share/doc/php-manual-en/xsltprocessor.removeparameter.html
    • /usr/share/doc/php-manual-en/xsltprocessor.setparameter.html
    • /usr/share/doc/php-manual-en/xsltprocessor.setprofiling.html
    • /usr/share/doc/php-manual-en/xsltprocessor.setsecurityprefs.html
    • /usr/share/doc/php-manual-en/xsltprocessor.transformtodoc.html
    • /usr/share/doc/php-manual-en/xsltprocessor.transformtouri.html
    • /usr/share/doc/php-manual-en/xsltprocessor.transformtoxml.html
    • /usr/share/doc/php-manual-en/yaf-action-abstract.execute.html
    • /usr/share/doc/php-manual-en/yaf-action-abstract.getcontroller.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yaf-application.bootstrap.html
    • /usr/share/doc/php-manual-en/yaf-application.clearlasterror.html
    • /usr/share/doc/php-manual-en/yaf-application.clone.html
    • /usr/share/doc/php-manual-en/yaf-application.construct.html
    • /usr/share/doc/php-manual-en/yaf-application.destruct.html
    • /usr/share/doc/php-manual-en/yaf-application.environ.html
    • /usr/share/doc/php-manual-en/yaf-application.execute.html
    • /usr/share/doc/php-manual-en/yaf-application.getappdirectory.html
    • /usr/share/doc/php-manual-en/yaf-application.getconfig.html
    • /usr/share/doc/php-manual-en/yaf-application.getdispatcher.html
    • /usr/share/doc/php-manual-en/yaf-application.getlasterrormsg.html
    • /usr/share/doc/php-manual-en/yaf-application.getlasterrorno.html
    • /usr/share/doc/php-manual-en/yaf-application.getmodules.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yaf-application.setappdirectory.html
    • /usr/share/doc/php-manual-en/yaf-application.sleep.html
    • /usr/share/doc/php-manual-en/yaf-application.wakeup.html
    • /usr/share/doc/php-manual-en/yaf-config-abstract.get.html
    • /usr/share/doc/php-manual-en/yaf-config-abstract.readonly.html
    • /usr/share/doc/php-manual-en/yaf-config-abstract.set.html
    • /usr/share/doc/php-manual-en/yaf-config-abstract.toarray.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.construct.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.count.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.current.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.get.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.isset.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yaf-config-ini.offsetexists.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.offsetget.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.offsetset.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.offsetunset.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.readonly.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.rewind.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.set.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.toarray.html
    • /usr/share/doc/php-manual-en/yaf-config-ini.valid.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.construct.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.count.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.current.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.get.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.isset.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yaf-config-simple.offsetexists.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.offsetget.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.offsetset.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.offsetunset.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.readonly.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.rewind.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.set.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.toarray.html
    • /usr/share/doc/php-manual-en/yaf-config-simple.valid.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.clone.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.construct.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.display.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.forward.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getinvokearg.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getinvokeargs.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getmodulename.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getrequest.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getresponse.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getview.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.getviewpath.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.init.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.initview.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.redirect.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.render.html
    • /usr/share/doc/php-manual-en/yaf-controller-abstract.setviewpath.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.autorender.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.catchexception.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.clone.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.construct.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.disableview.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.dispatch.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.enableview.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.flushinstantly.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.getapplication.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.getinstance.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.getrequest.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.getrouter.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.initview.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.registerplugin.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.returnresponse.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.setdefaultaction.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.setdefaultcontroller.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.setdefaultmodule.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.seterrorhandler.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.setrequest.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.setview.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.sleep.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.throwexception.html
    • /usr/share/doc/php-manual-en/yaf-dispatcher.wakeup.html
    • /usr/share/doc/php-manual-en/yaf-exception.construct.html
    • /usr/share/doc/php-manual-en/yaf-exception.getprevious.html
    • /usr/share/doc/php-manual-en/yaf-loader.autoload.html
    • /usr/share/doc/php-manual-en/yaf-loader.clearlocalnamespace.html
    • /usr/share/doc/php-manual-en/yaf-loader.clone.html
    • /usr/share/doc/php-manual-en/yaf-loader.construct.html
    • /usr/share/doc/php-manual-en/yaf-loader.getinstance.html
    • /usr/share/doc/php-manual-en/yaf-loader.getlibrarypath.html
    • /usr/share/doc/php-manual-en/yaf-loader.getlocalnamespace.html
    • /usr/share/doc/php-manual-en/yaf-loader.import.html
    • /usr/share/doc/php-manual-en/yaf-loader.islocalname.html
    • /usr/share/doc/php-manual-en/yaf-loader.registerlocalnamespace.html
    • /usr/share/doc/php-manual-en/yaf-loader.setlibrarypath.html
    • /usr/share/doc/php-manual-en/yaf-loader.sleep.html
    • /usr/share/doc/php-manual-en/yaf-loader.wakeup.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.dispatchloopshutdown.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.dispatchloopstartup.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.postdispatch.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.predispatch.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.preresponse.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.routershutdown.html
    • /usr/share/doc/php-manual-en/yaf-plugin-abstract.routerstartup.html
    • /usr/share/doc/php-manual-en/yaf-registry.clone.html
    • /usr/share/doc/php-manual-en/yaf-registry.construct.html
    • /usr/share/doc/php-manual-en/yaf-registry.del.html
    • /usr/share/doc/php-manual-en/yaf-registry.get.html
    • /usr/share/doc/php-manual-en/yaf-registry.has.html
    • /usr/share/doc/php-manual-en/yaf-registry.set.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getactionname.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getbaseuri.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getcontrollername.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getenv.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getexception.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getlanguage.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getmethod.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getmodulename.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getparam.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getparams.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getrequesturi.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.getserver.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.iscli.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isdispatched.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isget.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.ishead.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isoptions.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.ispost.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isput.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isrouted.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.isxmlhttprequest.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setactionname.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setbaseuri.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setcontrollername.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setdispatched.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setmodulename.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setparam.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setrequesturi.html
    • /usr/share/doc/php-manual-en/yaf-request-abstract.setrouted.html
    • /usr/share/doc/php-manual-en/yaf-request-http.clone.html
    • /usr/share/doc/php-manual-en/yaf-request-http.construct.html
    • /usr/share/doc/php-manual-en/yaf-request-http.get.html
    • /usr/share/doc/php-manual-en/yaf-request-http.getcookie.html
    • /usr/share/doc/php-manual-en/yaf-request-http.getfiles.html
    • /usr/share/doc/php-manual-en/yaf-request-http.getpost.html
    • /usr/share/doc/php-manual-en/yaf-request-http.getquery.html
    • /usr/share/doc/php-manual-en/yaf-request-http.getrequest.html
    • /usr/share/doc/php-manual-en/yaf-request-http.isxmlhttprequest.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.clone.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.construct.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.get.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.getcookie.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.getfiles.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.getpost.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.getquery.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.getrequest.html
    • /usr/share/doc/php-manual-en/yaf-request-simple.isxmlhttprequest.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.appendbody.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.clearbody.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.clearheaders.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.clone.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.construct.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.destruct.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.getbody.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.getheader.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.prependbody.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.response.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.setallheaders.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.setbody.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.setheader.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.setredirect.html
    • /usr/share/doc/php-manual-en/yaf-response-abstract.tostring.html
    • /usr/share/doc/php-manual-en/yaf-route-interface.route.html
    • /usr/share/doc/php-manual-en/yaf-route-map.construct.html
    • /usr/share/doc/php-manual-en/yaf-route-map.route.html
    • /usr/share/doc/php-manual-en/yaf-route-regex.construct.html
    • /usr/share/doc/php-manual-en/yaf-route-regex.route.html
    • /usr/share/doc/php-manual-en/yaf-route-rewrite.construct.html
    • /usr/share/doc/php-manual-en/yaf-route-rewrite.route.html
    • /usr/share/doc/php-manual-en/yaf-route-simple.construct.html
    • /usr/share/doc/php-manual-en/yaf-route-simple.route.html
    • /usr/share/doc/php-manual-en/yaf-route-static.match.html
    • /usr/share/doc/php-manual-en/yaf-route-static.route.html
    • /usr/share/doc/php-manual-en/yaf-route-supervar.construct.html
    • /usr/share/doc/php-manual-en/yaf-route-supervar.route.html
    • /usr/share/doc/php-manual-en/yaf-router.addconfig.html
    • /usr/share/doc/php-manual-en/yaf-router.addroute.html
    • /usr/share/doc/php-manual-en/yaf-router.construct.html
    • /usr/share/doc/php-manual-en/yaf-router.getcurrentroute.html
    • /usr/share/doc/php-manual-en/yaf-router.getroute.html
    • /usr/share/doc/php-manual-en/yaf-router.getroutes.html
    • /usr/share/doc/php-manual-en/yaf-router.route.html
    • /usr/share/doc/php-manual-en/yaf-session.clone.html
    • /usr/share/doc/php-manual-en/yaf-session.construct.html
    • /usr/share/doc/php-manual-en/yaf-session.count.html
    • /usr/share/doc/php-manual-en/yaf-session.current.html
    • /usr/share/doc/php-manual-en/yaf-session.del.html
    • /usr/share/doc/php-manual-en/yaf-session.get.html
    • /usr/share/doc/php-manual-en/yaf-session.getinstance.html
    • /usr/share/doc/php-manual-en/yaf-session.has.html
    • /usr/share/doc/php-manual-en/yaf-session.isset.html
    • /usr/share/doc/php-manual-en/yaf-session.key.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yaf-session.offsetexists.html
    • /usr/share/doc/php-manual-en/yaf-session.offsetget.html
    • /usr/share/doc/php-manual-en/yaf-session.offsetset.html
    • /usr/share/doc/php-manual-en/yaf-session.offsetunset.html
    • /usr/share/doc/php-manual-en/yaf-session.rewind.html
    • /usr/share/doc/php-manual-en/yaf-session.set.html
    • /usr/share/doc/php-manual-en/yaf-session.sleep.html
    • /usr/share/doc/php-manual-en/yaf-session.start.html
    • /usr/share/doc/php-manual-en/yaf-session.unset.html
    • /usr/share/doc/php-manual-en/yaf-session.valid.html
    • /usr/share/doc/php-manual-en/yaf-session.wakeup.html
    • /usr/share/doc/php-manual-en/yaf-view-interface.assign.html
    • /usr/share/doc/php-manual-en/yaf-view-interface.display.html
    • /usr/share/doc/php-manual-en/yaf-view-interface.getscriptpath.html
    • /usr/share/doc/php-manual-en/yaf-view-interface.render.html
    • /usr/share/doc/php-manual-en/yaf-view-interface.setscriptpath.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.assign.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.assignref.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.clear.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.construct.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.display.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.eval.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.get.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.getscriptpath.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.isset.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.render.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.set.html
    • /usr/share/doc/php-manual-en/yaf-view-simple.setscriptpath.html
    • /usr/share/doc/php-manual-en/yaf.appconfig.html
    • /usr/share/doc/php-manual-en/yaf.configuration.html
    • /usr/share/doc/php-manual-en/yaf.constants.html
    • /usr/share/doc/php-manual-en/yaf.installation.html
    • /usr/share/doc/php-manual-en/yaf.requirements.html
    • /usr/share/doc/php-manual-en/yaf.resources.html
    • /usr/share/doc/php-manual-en/yaf.setup.html
    • /usr/share/doc/php-manual-en/yaf.tutorials.html
    • /usr/share/doc/php-manual-en/yaml.callbacks.emit.html
    • /usr/share/doc/php-manual-en/yaml.callbacks.html
    • /usr/share/doc/php-manual-en/yaml.callbacks.parse.html
    • /usr/share/doc/php-manual-en/yaml.configuration.html
    • /usr/share/doc/php-manual-en/yaml.constants.html
    • /usr/share/doc/php-manual-en/yaml.examples.html
    • /usr/share/doc/php-manual-en/yaml.installation.html
    • /usr/share/doc/php-manual-en/yaml.requirements.html
    • /usr/share/doc/php-manual-en/yaml.resources.html
    • /usr/share/doc/php-manual-en/yaml.setup.html
    • /usr/share/doc/php-manual-en/yar-client-exception.gettype.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yar-client.construct.html
    • /usr/share/doc/php-manual-en/yar-client.setopt.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/yar-concurrent-client.loop.html
    • /usr/share/doc/php-manual-en/yar-server-exception.gettype.html
    • /usr/share/doc/php-manual-en/yar-server.construct.html
    • /usr/share/doc/php-manual-en/yar-server.handle.html
    • /usr/share/doc/php-manual-en/yar.configuration.html
    • /usr/share/doc/php-manual-en/yar.constants.html
    • /usr/share/doc/php-manual-en/yar.examples.html
    • /usr/share/doc/php-manual-en/yar.installation.html
    • /usr/share/doc/php-manual-en/yar.requirements.html
    • /usr/share/doc/php-manual-en/yar.resources.html
    • /usr/share/doc/php-manual-en/yar.setup.html
    • /usr/share/doc/php-manual-en/yaz.configuration.html
    • /usr/share/doc/php-manual-en/yaz.constants.html
    • /usr/share/doc/php-manual-en/yaz.examples.html
    • /usr/share/doc/php-manual-en/yaz.installation.html
    • /usr/share/doc/php-manual-en/yaz.requirements.html
    • /usr/share/doc/php-manual-en/yaz.resources.html
    • /usr/share/doc/php-manual-en/yaz.setup.html
    • /usr/share/doc/php-manual-en/zip.configuration.html
    • /usr/share/doc/php-manual-en/zip.constants.html
    • /usr/share/doc/php-manual-en/zip.examples.html
    • /usr/share/doc/php-manual-en/zip.installation.html
    • /usr/share/doc/php-manual-en/zip.requirements.html
    • /usr/share/doc/php-manual-en/zip.resources.html
    • /usr/share/doc/php-manual-en/zip.setup.html
    • /usr/share/doc/php-manual-en/ziparchive.addemptydir.html
    • /usr/share/doc/php-manual-en/ziparchive.addfile.html
    • /usr/share/doc/php-manual-en/ziparchive.addfromstring.html
    • /usr/share/doc/php-manual-en/ziparchive.addglob.html
    • /usr/share/doc/php-manual-en/ziparchive.addpattern.html
    • /usr/share/doc/php-manual-en/ziparchive.close.html
    • /usr/share/doc/php-manual-en/ziparchive.deleteindex.html
    • /usr/share/doc/php-manual-en/ziparchive.deletename.html
    • /usr/share/doc/php-manual-en/ziparchive.extractto.html
    • /usr/share/doc/php-manual-en/ziparchive.getarchivecomment.html
    • /usr/share/doc/php-manual-en/ziparchive.getcommentindex.html
    • /usr/share/doc/php-manual-en/ziparchive.getcommentname.html
    • /usr/share/doc/php-manual-en/ziparchive.getfromindex.html
    • /usr/share/doc/php-manual-en/ziparchive.getfromname.html
    • /usr/share/doc/php-manual-en/ziparchive.getnameindex.html
    • /usr/share/doc/php-manual-en/ziparchive.getstatusstring.html
    • /usr/share/doc/php-manual-en/ziparchive.getstream.html
    • /usr/share/doc/php-manual-en/ziparchive.locatename.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/ziparchive.renameindex.html
    • /usr/share/doc/php-manual-en/ziparchive.renamename.html
    • /usr/share/doc/php-manual-en/ziparchive.setarchivecomment.html
    • /usr/share/doc/php-manual-en/ziparchive.setcommentindex.html
    • /usr/share/doc/php-manual-en/ziparchive.setcommentname.html
    • /usr/share/doc/php-manual-en/ziparchive.statindex.html
    • /usr/share/doc/php-manual-en/ziparchive.statname.html
    • /usr/share/doc/php-manual-en/ziparchive.unchangeall.html
    • /usr/share/doc/php-manual-en/ziparchive.unchangearchive.html
    • /usr/share/doc/php-manual-en/ziparchive.unchangeindex.html
    • /usr/share/doc/php-manual-en/ziparchive.unchangename.html
    • /usr/share/doc/php-manual-en/zlib.configuration.html
    • /usr/share/doc/php-manual-en/zlib.constants.html
    • /usr/share/doc/php-manual-en/zlib.examples.html
    • /usr/share/doc/php-manual-en/zlib.installation.html
    • /usr/share/doc/php-manual-en/zlib.requirements.html
    • /usr/share/doc/php-manual-en/zlib.resources.html
    • /usr/share/doc/php-manual-en/zlib.setup.html
    • /usr/share/doc/php-manual-en/zmq.construct.html
    • /usr/share/doc/php-manual-en/zmq.requirements.html
    • /usr/share/doc/php-manual-en/zmq.setup.html
    • /usr/share/doc/php-manual-en/zmqcontext.construct.html
    • /usr/share/doc/php-manual-en/zmqcontext.getopt.html
    • /usr/share/doc/php-manual-en/zmqcontext.getsocket.html
    • /usr/share/doc/php-manual-en/zmqcontext.ispersistent.html
    • /usr/share/doc/php-manual-en/zmqcontext.setopt.html
    • /usr/share/doc/php-manual-en/zmqdevice.construct.html
    • /usr/share/doc/php-manual-en/zmqdevice.getidletimeout.html
    • /usr/share/doc/php-manual-en/zmqdevice.gettimertimeout.html
    • /usr/share/doc/php-manual-en/
    • /usr/share/doc/php-manual-en/zmqdevice.setidlecallback.html
    • /usr/share/doc/php-manual-en/zmqdevice.setidletimeout.html
    • /usr/share/doc/php-manual-en/zmqdevice.settimercallback.html
    • /usr/share/doc/php-manual-en/zmqdevice.settimertimeout.html
    • /usr/share/doc/php-manual-en/zmqpoll.add.html
    • /usr/share/doc/php-manual-en/zmqpoll.clear.html
    • /usr/share/doc/php-manual-en/zmqpoll.count.html
    • /usr/share/doc/php-manual-en/zmqpoll.getlasterrors.html
    • /usr/share/doc/php-manual-en/zmqpoll.poll.html
    • /usr/share/doc/php-manual-en/zmqpoll.remove.html
    • /usr/share/doc/php-manual-en/zmqsocket.bind.html
    • /usr/share/doc/php-manual-en/zmqsocket.connect.html
    • /usr/share/doc/php-manual-en/zmqsocket.construct.html
    • /usr/share/doc/php-manual-en/zmqsocket.disconnect.html
    • /usr/share/doc/php-manual-en/zmqsocket.getendpoints.html
    • /usr/share/doc/php-manual-en/zmqsocket.getpersistentid.html
    • /usr/share/doc/php-manual-en/zmqsocket.getsockettype.html
    • /usr/share/doc/php-manual-en/zmqsocket.getsockopt.html
    • /usr/share/doc/php-manual-en/zmqsocket.ispersistent.html
    • /usr/share/doc/php-manual-en/zmqsocket.recv.html
    • /usr/share/doc/php-manual-en/zmqsocket.recvmulti.html
    • /usr/share/doc/php-manual-en/zmqsocket.send.html
    • /usr/share/doc/php-manual-en/zmqsocket.sendmulti.html
    • /usr/share/doc/php-manual-en/zmqsocket.setsockopt.html
    • /usr/share/doc/php-manual-en/zmqsocket.unbind.html
    • /usr/share/doc/php-manual-en/images/0baa1b9fae6aec55bbb73037f3016001-xkcd-goto.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-gc-algorithm.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-gc-benchmark.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-leak-array.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-loop-array.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-simple-array.png
    • /usr/share/doc/php-manual-en/images/12f37b1c6963c1c5c18f30495416a197-simple-array2.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imageantialias.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagearc.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagechar.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecharup.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecolorallocatealpha.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecolortransparent.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imageconvolution_emboss.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imageconvolution_gaussian.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecopy.gif
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecopyresampled_2.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecopyresized.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreate.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreatefromgif.gif
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreatefromjpeg.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreatefrompng.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreatefromstring.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagecreatetruecolor.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagedashedline.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imageellipse.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefill.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilledarc.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilledellipse.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilledpolygon.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilledrectangle.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilltoborder.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefilterpixelate.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagefliphorizontal.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imageflipvertical.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagejpeg.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagelayereffect.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagepolygon.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagerectangle.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagerotate.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagesetbrush.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagesetpixel.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagesetstyle.jpg
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagesetthickness.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagesettile.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagestring.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagestringup.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-imagettftext.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-watermark-merged.png
    • /usr/share/doc/php-manual-en/images/21009b70229598c6a80eef8b45bf282b-watermarks.png
    • /usr/share/doc/php-manual-en/images/4fd86c7f1b197d1d954ad0f4b033dc93-yar.png
    • /usr/share/doc/php-manual-en/images/55c7816ef6df6821f05678a68b4e4e63-mymemflow.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6anonauth.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6defaultdoc.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlericon.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlermap.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7vistacgi.png
    • /usr/share/doc/php-manual-en/images/b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7w2k8cgi.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.01-internal-structure.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.04-cross-converter.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.05-reference-test.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.06-variable-creation.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.07-warning-messages.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.08-phpinfo-output.png
    • /usr/share/doc/php-manual-en/images/befd863081615f539082d9ff76bf7b39-zend.09-execution-info.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-adaptiveBlurImage.gif
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-distortImage.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_intermediate.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_result.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-hello_world.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-hello_world_reflection.png
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-importimagepixels.jpg
    • /usr/share/doc/php-manual-en/images/c0d23d2d6769e53e24a1b3136c064577-php_logo.png
    • /usr/share/doc/php-manual-en/images/e88cefb5c3fca5060e2490b9763c4433-readfile.png
    • /usr/share/doc/php-manual-en/images/fa7c5b5f326e3c4a6cc9db19e7edbaf0-xkcd-bobby-tables.png